| UniProt ID | RNAS7_HUMAN | |
|---|---|---|
| UniProt AC | Q9H1E1 | |
| Protein Name | Ribonuclease 7 | |
| Gene Name | RNASE7 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 156 | |
| Subcellular Localization | Secreted . Detected in urine. | |
| Protein Description | Exhibits a potent RNase activity. [PubMed: 12244054] | |
| Protein Sequence | MAPARAGFCPLLLLLLLGLWVAEIPVSAKPKGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQSHGAVSLTMCKLTSGKHPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPVHLDRVL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 56 | Acetylation | QACNSAMKNINKHTK HHHHHHHHHHHHHHH | 55.16 | 7926807 | |
| 63 | Acetylation | KNINKHTKRCKDLNT HHHHHHHHHHHCHHH | 56.36 | 7926815 | |
| 127 | N-linked_Glycosylation | RYKEKRQNKSYVVAC CCCCCCCCCCEEEEC | 38.99 | UniProtKB CARBOHYD | |
| 130 | Phosphorylation | EKRQNKSYVVACKPP CCCCCCCEEEECCCC | 10.68 | - | |
| 142 | Phosphorylation | KPPQKKDSQQFHLVP CCCCCCCCCCEEEEE | 34.46 | 20068231 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RNAS7_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RNAS7_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RNAS7_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RINI_HUMAN | RNH1 | physical | 26186194 | |
| RINI_HUMAN | RNH1 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...