| UniProt ID | LYPA1_HUMAN | |
|---|---|---|
| UniProt AC | O75608 | |
| Protein Name | Acyl-protein thioesterase 1 | |
| Gene Name | LYPLA1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 230 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | Hydrolyzes fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS. Has depalmitoylating activity toward KCNMA1. Has low lysophospholipase activity.. | |
| Protein Sequence | MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 89 (in isoform 2) | Ubiquitination | - | 4.10 | 21890473 | |
| 97 | Ubiquitination | KQAAENIKALIDQEV HHHHHHHHHHHCHHH | 49.04 | - | |
| 97 | Succinylation | KQAAENIKALIDQEV HHHHHHHHHHHCHHH | 49.04 | 23954790 | |
| 105 | Ubiquitination | ALIDQEVKNGIPSNR HHHCHHHHCCCCCCC | 49.02 | 21906983 | |
| 105 | Acetylation | ALIDQEVKNGIPSNR HHHCHHHHCCCCCCC | 49.02 | 25953088 | |
| 105 (in isoform 1) | Ubiquitination | - | 49.02 | 21890473 | |
| 144 | S-palmitoylation | AGVTALSCWLPLRAS HCCCCEEEEEEHHHC | 4.50 | 29575903 | |
| 190 | Ubiquitination | SLTVEKLKTLVNPAN CEEHHHHHHHCCCCC | 51.37 | - | |
| 202 | Phosphorylation | PANVTFKTYEGMMHS CCCCEEEECCHHCCH | 23.71 | 24043423 | |
| 203 | Phosphorylation | ANVTFKTYEGMMHSS CCCEEEECCHHCCHH | 15.86 | 22210691 | |
| 208 (in isoform 2) | Ubiquitination | - | 13.99 | 21890473 | |
| 209 | Phosphorylation | TYEGMMHSSCQQEMM ECCHHCCHHHHHHHH | 18.21 | 24043423 | |
| 210 | Phosphorylation | YEGMMHSSCQQEMMD CCHHCCHHHHHHHHH | 10.98 | 24043423 | |
| 211 | Glutathionylation | EGMMHSSCQQEMMDV CHHCCHHHHHHHHHH | 5.62 | 22555962 | |
| 224 | Acetylation | DVKQFIDKLLPPID- HHHHHHHHHCCCCC- | 47.29 | - | |
| 224 | Ubiquitination | DVKQFIDKLLPPID- HHHHHHHHHCCCCC- | 47.29 | 2190698 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LYPA1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LYPA1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LYPA1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| LYPA1_HUMAN | LYPLA1 | physical | 11080636 | |
| APT_HUMAN | APRT | physical | 26344197 | |
| ASNS_HUMAN | ASNS | physical | 26344197 | |
| DPYL2_HUMAN | DPYSL2 | physical | 26344197 | |
| PRDX6_HUMAN | PRDX6 | physical | 26344197 | |
| TTC38_HUMAN | TTC38 | physical | 26344197 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
