UniProt ID | LYPA1_HUMAN | |
---|---|---|
UniProt AC | O75608 | |
Protein Name | Acyl-protein thioesterase 1 | |
Gene Name | LYPLA1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 230 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Hydrolyzes fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS. Has depalmitoylating activity toward KCNMA1. Has low lysophospholipase activity.. | |
Protein Sequence | MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
89 (in isoform 2) | Ubiquitination | - | 4.10 | 21890473 | |
97 | Ubiquitination | KQAAENIKALIDQEV HHHHHHHHHHHCHHH | 49.04 | - | |
97 | Succinylation | KQAAENIKALIDQEV HHHHHHHHHHHCHHH | 49.04 | 23954790 | |
105 | Ubiquitination | ALIDQEVKNGIPSNR HHHCHHHHCCCCCCC | 49.02 | 21906983 | |
105 | Acetylation | ALIDQEVKNGIPSNR HHHCHHHHCCCCCCC | 49.02 | 25953088 | |
105 (in isoform 1) | Ubiquitination | - | 49.02 | 21890473 | |
144 | S-palmitoylation | AGVTALSCWLPLRAS HCCCCEEEEEEHHHC | 4.50 | 29575903 | |
190 | Ubiquitination | SLTVEKLKTLVNPAN CEEHHHHHHHCCCCC | 51.37 | - | |
202 | Phosphorylation | PANVTFKTYEGMMHS CCCCEEEECCHHCCH | 23.71 | 24043423 | |
203 | Phosphorylation | ANVTFKTYEGMMHSS CCCEEEECCHHCCHH | 15.86 | 22210691 | |
208 (in isoform 2) | Ubiquitination | - | 13.99 | 21890473 | |
209 | Phosphorylation | TYEGMMHSSCQQEMM ECCHHCCHHHHHHHH | 18.21 | 24043423 | |
210 | Phosphorylation | YEGMMHSSCQQEMMD CCHHCCHHHHHHHHH | 10.98 | 24043423 | |
211 | Glutathionylation | EGMMHSSCQQEMMDV CHHCCHHHHHHHHHH | 5.62 | 22555962 | |
224 | Acetylation | DVKQFIDKLLPPID- HHHHHHHHHCCCCC- | 47.29 | - | |
224 | Ubiquitination | DVKQFIDKLLPPID- HHHHHHHHHCCCCC- | 47.29 | 2190698 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LYPA1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LYPA1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LYPA1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
LYPA1_HUMAN | LYPLA1 | physical | 11080636 | |
APT_HUMAN | APRT | physical | 26344197 | |
ASNS_HUMAN | ASNS | physical | 26344197 | |
DPYL2_HUMAN | DPYSL2 | physical | 26344197 | |
PRDX6_HUMAN | PRDX6 | physical | 26344197 | |
TTC38_HUMAN | TTC38 | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...