OTU1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: OTU1_HUMAN
• UniProt AC: Q5VVQ6
• Protein Name: Ubiquitin thioesterase OTU1
• Gene Name: YOD1
• Organism: Homo sapiens (Human).
• Sequence Length: 348
• Subcellular Localization: Cytoplasm . Recruited to damaged lysosomes decorated with K48-linked ubiquitin chains.
• Protein Description: Hydrolase that can remove conjugated ubiquitin from proteins and participates in endoplasmic reticulum-associated degradation (ERAD) for misfolded lumenal proteins. May act by triming the ubiquitin chain on the associated substrate to facilitate their threading through the VCP/p97 pore. Ubiquitin moieties on substrates may present a steric impediment to the threading process when the substrate is transferred to the VCP pore and threaded through VCP's axial channel. Mediates deubiquitination of 'Lys-27'-, 'Lys-29'- and 'Lys-33'-linked polyubiquitin chains. Also able to hydrolyze 'Lys-11'-linked ubiquitin chains. Cleaves both polyubiquitin and di-ubiquitin. May play a role in macroautophagy, regulating for instance the clearance of damaged lysosomes. May recruit PLAA, UBXN6 and VCP to damaged lysosome membranes decorated with K48-linked ubiquitin chains and remove these chains allowing autophagosome formation. [PubMed: 27753622]
• Protein Sequence: MFGPAKGRHFGVHPAPGFPGGVSQQAAGTKAGPAGAWPVGSRTDTMWRLRCKAKDGTHVLQGLSSRTRVRELQGQIAAITGIAPGGQRILVGYPPECLDLSNGDTILEDLPIQSGDMLIIEEDQTRPRSSPAFTKRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVASDPDFYSEAILGKTNQEYCDWIKRDDTWGGAIEISILSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFPDPDTPPLTIFSSNDDIVLVQALELADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTNFGEV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
54	Ubiquitination	WRLRCKAKDGTHVLQ EEEEEEECCCCCCCC	42.03	22053931
91	Ubiquitination	PGGQRILVGYPPECL CCCCEEEEECCHHHC	6.85	32142685
129	Phosphorylation	EDQTRPRSSPAFTKR CCCCCCCCCCCCHHH	43.27	23403867
130	Phosphorylation	DQTRPRSSPAFTKRG CCCCCCCCCCCHHHC	22.87	27794612
135	Ubiquitination	RSSPAFTKRGASSYV CCCCCCHHHCHHHHH	42.24	32142685
139	Phosphorylation	AFTKRGASSYVRETL CCHHHCHHHHHHHHC	25.65	28857561
140	Phosphorylation	FTKRGASSYVRETLP CHHHCHHHHHHHHCC	27.41	26434776
145	Phosphorylation	ASSYVRETLPVLTRT HHHHHHHHCCEEEEE	26.29	22985185
150	Phosphorylation	RETLPVLTRTVVPAD HHHCCEEEEEEECCC	25.24	20068231
213 (in isoform 2)	Ubiquitination	-	1.35	21906983
213	Ubiquitination	NQEYCDWIKRDDTWG CHHHCHHHHCCCCCC	1.35	22053931
226	Phosphorylation	WGGAIEISILSKFYQ CCCCEEEEHHHHCCC	12.51	24719451
257 (in isoform 1)	Ubiquitination	-	31.83	21906983
257	Ubiquitination	GEDAGYTKRVLLIYD CCCCCCCCEEEEEEC	31.83	32142685
281	Ubiquitination	NFPDPDTPPLTIFSS CCCCCCCCCEEEECC	29.32	22505724
317	Phosphorylation	FTDVNRFTLRCMVCQ CCCCCHHHHHHHHCC	15.28	24719451
325	Ubiquitination	LRCMVCQKGLTGQAE HHHHHCCCCCCCHHH	51.24	22505724
328	Phosphorylation	MVCQKGLTGQAEARE HHCCCCCCCHHHHHH	35.60	23403867

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of OTU1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of OTU1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of OTU1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BL1S5_HUMAN	BLOC1S5	physical	19615732
THOC3_HUMAN	THOC3	physical	19615732
TERA_HUMAN	VCP	physical	19818707
UBC_HUMAN	UBC	physical	19818707
DERL1_HUMAN	DERL1	physical	19818707
FAF2_HUMAN	FAF2	physical	19818707
SYVN1_HUMAN	SYVN1	physical	24068323
AMFR_HUMAN	AMFR	physical	24068323
TERA_HUMAN	VCP	physical	24417208
UBC_HUMAN	UBC	physical	23827681
UBE3A_HUMAN	UBE3A	physical	23827681
NEDD4_HUMAN	NEDD4	physical	23827681
RIPK1_HUMAN	RIPK1	physical	23827681
NPL4_HUMAN	NPLOC4	physical	19818707
UFD1_HUMAN	UFD1L	physical	19818707
FA98B_HUMAN	FAM98B	physical	26344197
UBC_HUMAN	UBC	physical	27066941
TRAF6_HUMAN	TRAF6	physical	28244869
TERA_HUMAN	VCP	physical	28244869
BIRC3_HUMAN	BIRC3	physical	28244869
SHRPN_HUMAN	SHARPIN	physical	28244869

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.