SPA12_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SPA12_HUMAN
• UniProt AC: Q8IW75
• Protein Name: Serpin A12
• Gene Name: SERPINA12
• Organism: Homo sapiens (Human).
• Sequence Length: 414
• Subcellular Localization: Secreted.
• Protein Description: Adipokine that modulates insulin action by specifically inhibiting its target protease KLK7 in white adipose tissues..
• Protein Sequence: MNPTLGLAIFLAVLLTVKGLLKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFILPDEGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTEGAAGTGAQTLPMETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNPIGK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
24	Phosphorylation	VKGLLKPSFSPRNYK HHHHHCCCCCHHCHH	36.45	-
66	Phosphorylation	LLKKLAFYNPGRNIF HHHHHHHCCCCCCEE	18.16	30622161
221	N-linked_Glycosylation	WKHEFDPNVTKEEDF HHCCCCCCCCHHHHC	56.80	28668641
233	N-linked_Glycosylation	EDFFLEKNSSVKVPM HHCEECCCCCCCCCE	30.09	28668641
267	N-linked_Glycosylation	LEIPYQKNITAIFIL EEECCCCCEEEEEEC	22.71	28668641
346	Phosphorylation	TKIAPHRSLKVGEAV CEECCCCCCCHHHHH	29.52	27251275

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SPA12_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SPA12_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SPA12_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SUSD5_HUMAN	SUSD5	physical	28514442
K1549_HUMAN	KIAA1549	physical	28514442
LAMB1_HUMAN	LAMB1	physical	28514442
CTGE5_HUMAN	CTAGE5	physical	28514442
TXD15_HUMAN	TXNDC15	physical	28514442
GPR98_HUMAN	GPR98	physical	28514442
PNPT1_HUMAN	PNPT1	physical	28514442
NONO_HUMAN	NONO	physical	28514442
TGO1_HUMAN	MIA3	physical	28514442
TSN6_HUMAN	TSPAN6	physical	28514442
SE6L2_HUMAN	SEZ6L2	physical	28514442
LRP5_HUMAN	LRP5	physical	28514442
PTPRG_HUMAN	PTPRG	physical	28514442
ITA2_HUMAN	ITGA2	physical	28514442
ASPH_HUMAN	ASPH	physical	28514442
WDR75_HUMAN	WDR75	physical	28514442
TEN3_HUMAN	TENM3	physical	28514442
K319L_HUMAN	KIAA0319L	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.