| UniProt ID | TSN6_HUMAN | |
|---|---|---|
| UniProt AC | O43657 | |
| Protein Name | Tetraspanin-6 | |
| Gene Name | TSPAN6 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 245 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein. |
|
| Protein Description | ||
| Protein Sequence | MASPSRRLQTKPVITCFKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNVPFVLIATGTVIILLGTFGCFATCRASAWMLKLYAMFLTLVFLVELVAAIVGFVFRHEIKNSFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKLEDCTPQRDADKVNNEGCFIKVMTIIESEMGVVAGISFGVACFQLIGIFLAYCLSRAITNNQYEIV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 49 | Phosphorylation | GKVSLENYFSLLNEK CHHCHHHHHHHHCHH | 5.79 | 29759185 | |
| 51 | Phosphorylation | VSLENYFSLLNEKAT HCHHHHHHHHCHHCC | 22.91 | 29759185 | |
| 123 | "N6,N6-dimethyllysine" | HEIKNSFKNNYEKAL HHHHHHHHCCHHHHH | 44.07 | - | |
| 123 | Ubiquitination | HEIKNSFKNNYEKAL HHHHHHHHCCHHHHH | 44.07 | - | |
| 123 | Methylation | HEIKNSFKNNYEKAL HHHHHHHHCCHHHHH | 44.07 | 23644510 | |
| 128 | 2-Hydroxyisobutyrylation | SFKNNYEKALKQYNS HHHCCHHHHHHHHCC | 48.97 | - | |
| 128 | Ubiquitination | SFKNNYEKALKQYNS HHHCCHHHHHHHHCC | 48.97 | 21906983 | |
| 131 | Ubiquitination | NNYEKALKQYNSTGD CCHHHHHHHHCCCCC | 56.44 | 21906983 | |
| 134 | N-linked_Glycosylation | EKALKQYNSTGDYRS HHHHHHHCCCCCHHH | 30.51 | UniProtKB CARBOHYD | |
| 146 | Ubiquitination | YRSHAVDKIQNTLHC HHHHHHHHHHHHHEC | 39.32 | - | |
| 160 | Methylation | CCGVTDYRDWTDTNY CCCCCCCCCCCCCCC | 35.48 | 115919069 | |
| 163 | Phosphorylation | VTDYRDWTDTNYYSE CCCCCCCCCCCCCCC | 36.92 | 29083192 | |
| 165 | Phosphorylation | DYRDWTDTNYYSEKG CCCCCCCCCCCCCCC | 20.11 | 29083192 | |
| 167 | Phosphorylation | RDWTDTNYYSEKGFP CCCCCCCCCCCCCCC | 15.51 | 29083192 | |
| 168 | Phosphorylation | DWTDTNYYSEKGFPK CCCCCCCCCCCCCCH | 16.66 | 29083192 | |
| 169 | Phosphorylation | WTDTNYYSEKGFPKS CCCCCCCCCCCCCHH | 23.60 | 29083192 | |
| 171 | Ubiquitination | DTNYYSEKGFPKSCC CCCCCCCCCCCHHHC | 60.97 | 2190698 | |
| 177 | S-palmitoylation | EKGFPKSCCKLEDCT CCCCCHHHCCCCCCC | 2.72 | 29575903 | |
| 178 | S-palmitoylation | KGFPKSCCKLEDCTP CCCCHHHCCCCCCCC | 7.91 | 29575903 | |
| 179 | Ubiquitination | GFPKSCCKLEDCTPQ CCCHHHCCCCCCCCC | 60.27 | - | |
| 183 | S-palmitoylation | SCCKLEDCTPQRDAD HHCCCCCCCCCCCHH | 4.34 | 29575903 | |
| 191 | Ubiquitination | TPQRDADKVNNEGCF CCCCCHHHCCCCCCE | 48.89 | - | |
| 242 | Phosphorylation | RAITNNQYEIV---- HHHHCCCCCCC---- | 15.11 | 28152594 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TSN6_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TSN6_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TSN6_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CHD3_HUMAN | CHD3 | physical | 16169070 | |
| LRIF1_HUMAN | LRIF1 | physical | 16169070 | |
| NSG2_HUMAN | HMP19 | physical | 21900206 | |
| MAVS_HUMAN | MAVS | physical | 22908223 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...