dbPTM

TREX2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TREX2_HUMAN
UniProt AC	Q9BQ50
Protein Name	Three prime repair exonuclease 2
Gene Name	TREX2
Organism	Homo sapiens (Human).
Sequence Length	279
Subcellular Localization	Nucleus .
Protein Description	Exonuclease with a preference for double-stranded DNA with mismatched 3' termini. May play a role in DNA repair..
Protein Sequence	MGRAGSPLPRSSWPRMDDCGSRSRCSPTLCSSLRTCYPRGNITMSEAPRAETFVFLDLEATGLPSVEPEIAELSLFAVHRSSLENPEHDESGALVLPRVLDKLTLCMCPERPFTAKASEITGLSSEGLARCRKAGFDGAVVRTLQAFLSRQAGPICLVAHNGFDYDFPLLCAELRRLGARLPRDTVCLDTLPALRGLDRAHSHGTRARGRQGYSLGSLFHRYFRAEPSAAHSAEGDVHTLLLIFLHRAAELLAWADEQARGWAHIEPMYLPPDDPSLEA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MGRAGSPLPRSSW --CCCCCCCCCCCCC	23.44	24719451
12	Phosphorylation	GSPLPRSSWPRMDDC CCCCCCCCCCCCCCC	42.24	24719451
26	Phosphorylation	CGSRSRCSPTLCSSL CCCCCCCCHHHHHHH	21.58	18669648
170	Phosphorylation	FDYDFPLLCAELRRL CCCCHHHHHHHHHHH	2.37	24719451
171	Phosphorylation	DYDFPLLCAELRRLG CCCHHHHHHHHHHHC	3.49	24719451
213	Phosphorylation	RARGRQGYSLGSLFH CCCCCCCCCHHHHHH	7.74	24719451
214	Phosphorylation	ARGRQGYSLGSLFHR CCCCCCCCHHHHHHH	32.83	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TREX2_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TREX2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TREX2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
TREX2_HUMAN	TREX2	physical	11279105

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TREX2_HUMAN

Related Literatures of Post-Translational Modification