UniProt ID | FOXS1_HUMAN | |
---|---|---|
UniProt AC | O43638 | |
Protein Name | Forkhead box protein S1 | |
Gene Name | FOXS1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 330 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcriptional repressor that suppresses transcription from the FASLG, FOXO3 and FOXO4 promoters. May have a role in the organization of the testicular vasculature (By similarity).. | |
Protein Sequence | MQQQPLPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFEHGSFLRRRRRFTRQTGAEGTRGPAKARRGPLRATSQDPGVPNATTGRQCSFPPELPDPKGLSFGGLVGAMPASMCPATTDGRPRPPMEPKEISTPKPACPGELPVATSSSSCPAFGFPAGFSEAESFNKAPTPVLSPESGIGSSYQCRLQALNFCMGADPGLEHLLASAAPSPAPPTPPGSLRAPLPLPTDHKEPWVAGGFPVQGGSGYPLGLTPCLYRTPGMFFFE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
55 | Phosphorylation | IMGRFAFYRHNRPGW HHHHHHHHCCCCCCH | 13.92 | - | |
65 | Phosphorylation | NRPGWQNSIRHNLSL CCCCHHHHHHHCCCC | 13.10 | 27251275 | |
116 | Methylation | RRRRRFTRQTGAEGT HHHHHHHHHHCCCCC | 29.38 | - | |
124 | Methylation | QTGAEGTRGPAKARR HHCCCCCCCCCHHCC | 61.01 | - | |
137 | Phosphorylation | RRGPLRATSQDPGVP CCCCCCCCCCCCCCC | 22.08 | 28857561 | |
138 | Phosphorylation | RGPLRATSQDPGVPN CCCCCCCCCCCCCCC | 31.44 | 28857561 | |
182 | Phosphorylation | ASMCPATTDGRPRPP HHHCCCCCCCCCCCC | 38.26 | 24719451 | |
210 | Phosphorylation | PGELPVATSSSSCPA CCCCCEECCCCCCCC | 29.40 | 27251275 | |
211 | Phosphorylation | GELPVATSSSSCPAF CCCCEECCCCCCCCC | 20.63 | 27251275 | |
212 | Phosphorylation | ELPVATSSSSCPAFG CCCEECCCCCCCCCC | 23.16 | 27251275 | |
213 | Phosphorylation | LPVATSSSSCPAFGF CCEECCCCCCCCCCC | 35.41 | 27251275 | |
214 | Phosphorylation | PVATSSSSCPAFGFP CEECCCCCCCCCCCC | 26.52 | 27251275 | |
229 | Phosphorylation | AGFSEAESFNKAPTP CCCCCHHHHCCCCCC | 40.96 | 26074081 | |
235 | Phosphorylation | ESFNKAPTPVLSPES HHHCCCCCCCCCCCC | 30.78 | 26074081 | |
239 | Phosphorylation | KAPTPVLSPESGIGS CCCCCCCCCCCCCCC | 27.19 | 26074081 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FOXS1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FOXS1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FOXS1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...