UniProt ID | HXB13_HUMAN | |
---|---|---|
UniProt AC | Q92826 | |
Protein Name | Homeobox protein Hox-B13 | |
Gene Name | HOXB13 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 284 | |
Subcellular Localization | Nucleus. | |
Protein Description | Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Binds preferentially to methylated DNA. [PubMed: 28473536] | |
Protein Sequence | MEPGNYATLDGAKDIEGLLGAGGGRNLVAHSPLTSHPAAPTLMPAVNYAPLDLPGSAEPPKQCHPCPGVPQGTSPAPVPYGYFGGGYYSCRVSRSSLKPCAQAATLAAYPAETPTAGEEYPSRPTEFAFYPGYPGTYQPMASYLDVSVVQTLGAPGEPRHDSLLPVDSYQSWALAGGWNSQMCCQGEQNPPGPFWKAAFADSSGQHPPDACAFRRGRKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKVKNSATP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MEPGNYATLDGAK --CCCCCCCCCCCCC | 13.59 | 28509920 | |
8 | Phosphorylation | MEPGNYATLDGAKDI CCCCCCCCCCCCCCH | 18.28 | 28509920 | |
31 | Phosphorylation | GRNLVAHSPLTSHPA CCCEEECCCCCCCCC | 16.33 | 29978859 | |
34 | Phosphorylation | LVAHSPLTSHPAAPT EEECCCCCCCCCCCC | 28.51 | 29978859 | |
35 | Phosphorylation | VAHSPLTSHPAAPTL EECCCCCCCCCCCCC | 34.85 | 29978859 | |
41 | Phosphorylation | TSHPAAPTLMPAVNY CCCCCCCCCCCCCCC | 30.84 | 25002506 | |
48 | Phosphorylation | TLMPAVNYAPLDLPG CCCCCCCCCCCCCCC | 11.73 | 27642862 | |
202 | Phosphorylation | WKAAFADSSGQHPPD HHHHHCCCCCCCCCC | 32.70 | 30631047 | |
203 | Phosphorylation | KAAFADSSGQHPPDA HHHHCCCCCCCCCCC | 42.91 | 30631047 | |
239 | Ubiquitination | EREYAANKFITKDKR HHHHHHHHCCCHHHH | 33.16 | - | |
250 | Phosphorylation | KDKRRKISAATSLSE HHHHHHCHHHCCCCH | 18.19 | - | |
254 | Phosphorylation | RKISAATSLSERQIT HHCHHHCCCCHHHHH | 25.77 | - | |
270 | Acetylation | WFQNRRVKEKKVLAK EECCCCCCCHHHHHH | 63.10 | 164241 | |
277 | Acetylation | KEKKVLAKVKNSATP CCHHHHHHHHHCCCC | 49.97 | 164245 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HXB13_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HXB13_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HXB13_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ZN490_HUMAN | ZNF490 | physical | 20211142 | |
ALX4_HUMAN | ALX4 | physical | 20211142 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...