UniProt ID | CMS1_HUMAN | |
---|---|---|
UniProt AC | Q9BQ75 | |
Protein Name | Protein CMSS1 | |
Gene Name | CMSS1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 279 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MADDLGDEWWENQPTGAGSSPEASDGEGEGDTEVMQQETVPVPVPSEKTKQPKECFLIQPKERKENTTKTRKRRKKKITDVLAKSEPKPGLPEDLQKLMKDYYSSRRLVIELEELNLPDSCFLKANDLTHSLSSYLKEICPKWVKLRKNHSEKKSVLMLIICSSAVRALELIRSMTAFRGDGKVIKLFAKHIKVQAQVKLLEKRVVHLGVGTPGRIKELVKQGGLNLSPLKFLVFDWNWRDQKLRRMMDIPEIRKEVFELLEMGVLSLCKSESLKLGLF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MADDLGDEWWENQ --CCCCCCCCHHHCC | 24719451 | ||
6 (in isoform 2) | Phosphorylation | - | 24719451 | ||
15 | Phosphorylation | EWWENQPTGAGSSPE CHHHCCCCCCCCCCC | 28348404 | ||
19 | Phosphorylation | NQPTGAGSSPEASDG CCCCCCCCCCCCCCC | 28348404 | ||
20 | Phosphorylation | QPTGAGSSPEASDGE CCCCCCCCCCCCCCC | 28348404 | ||
24 | Phosphorylation | AGSSPEASDGEGEGD CCCCCCCCCCCCCCC | 28348404 | ||
32 | Phosphorylation | DGEGEGDTEVMQQET CCCCCCCCCCCEECE | 28348404 | ||
35 | Ubiquitination | GEGDTEVMQQETVPV CCCCCCCCEECEECC | 33845483 | ||
39 | Phosphorylation | TEVMQQETVPVPVPS CCCCEECEECCCCCC | 28348404 | ||
43 | Ubiquitination | QQETVPVPVPSEKTK EECEECCCCCCCCCC | 23000965 | ||
46 | Phosphorylation | TVPVPVPSEKTKQPK EECCCCCCCCCCCCC | 20873877 | ||
46 | Ubiquitination | TVPVPVPSEKTKQPK EECCCCCCCCCCCCC | 23000965 | ||
53 | Ubiquitination | SEKTKQPKECFLIQP CCCCCCCCCCEECCC | 33845483 | ||
59 | Ubiquitination | PKECFLIQPKERKEN CCCCEECCCHHHCCC | 29967540 | ||
61 | Ubiquitination | ECFLIQPKERKENTT CCEECCCHHHCCCCC | 23000965 | ||
64 | Ubiquitination | LIQPKERKENTTKTR ECCCHHHCCCCCHHH | 23000965 | ||
66 | Ubiquitination | QPKERKENTTKTRKR CCHHHCCCCCHHHHH | 33845483 | ||
70 | Ubiquitination | RKENTTKTRKRRKKK HCCCCCHHHHHHHHH | 29967540 | ||
77 | Ubiquitination | TRKRRKKKITDVLAK HHHHHHHHHHHHHHH | 29967540 | ||
79 | Phosphorylation | KRRKKKITDVLAKSE HHHHHHHHHHHHHCC | 28555341 | ||
79 | Ubiquitination | KRRKKKITDVLAKSE HHHHHHHHHHHHHCC | 23000965 | ||
82 | Ubiquitination | KKKITDVLAKSEPKP HHHHHHHHHHCCCCC | 23000965 | ||
84 | Acetylation | KITDVLAKSEPKPGL HHHHHHHHCCCCCCC | 26051181 | ||
84 | Sumoylation | KITDVLAKSEPKPGL HHHHHHHHCCCCCCC | - | ||
84 | Ubiquitination | KITDVLAKSEPKPGL HHHHHHHHCCCCCCC | 33845483 | ||
88 | Trimethylation | VLAKSEPKPGLPEDL HHHHCCCCCCCCHHH | - | ||
88 | Methylation | VLAKSEPKPGLPEDL HHHHCCCCCCCCHHH | - | ||
88 | Ubiquitination | VLAKSEPKPGLPEDL HHHHCCCCCCCCHHH | 29967540 | ||
88 | Acetylation | VLAKSEPKPGLPEDL HHHHCCCCCCCCHHH | 26051181 | ||
97 | Ubiquitination | GLPEDLQKLMKDYYS CCCHHHHHHHHHHHH | 23000965 | ||
100 | Ubiquitination | EDLQKLMKDYYSSRR HHHHHHHHHHHHHCC | 23000965 | ||
102 | Phosphorylation | LQKLMKDYYSSRRLV HHHHHHHHHHHCCEE | 25072903 | ||
103 | Phosphorylation | QKLMKDYYSSRRLVI HHHHHHHHHHCCEEE | 25072903 | ||
124 | Ubiquitination | LPDSCFLKANDLTHS CCCCEEECHHHHHHC | 32142685 | ||
133 | Phosphorylation | NDLTHSLSSYLKEIC HHHHHCHHHHHHHHC | 25627689 | ||
137 | Acetylation | HSLSSYLKEICPKWV HCHHHHHHHHCHHHH | 26051181 | ||
142 | Acetylation | YLKEICPKWVKLRKN HHHHHCHHHHHHHCC | 25953088 | ||
142 | Ubiquitination | YLKEICPKWVKLRKN HHHHHCHHHHHHHCC | 32142685 | ||
167 | Methylation | IICSSAVRALELIRS HHHHHHHHHHHHHHH | 24129315 | ||
172 | Ubiquitination | AVRALELIRSMTAFR HHHHHHHHHHHHHCC | 29967540 | ||
174 | Phosphorylation | RALELIRSMTAFRGD HHHHHHHHHHHCCCC | 27251275 | ||
175 | Ubiquitination | ALELIRSMTAFRGDG HHHHHHHHHHCCCCC | 29967540 | ||
181 | Ubiquitination | SMTAFRGDGKVIKLF HHHHCCCCCHHHHHH | 29967540 | ||
190 | Ubiquitination | KVIKLFAKHIKVQAQ HHHHHHHHHCHHHHH | 29967540 | ||
190 | Acetylation | KVIKLFAKHIKVQAQ HHHHHHHHHCHHHHH | - | ||
193 | Ubiquitination | KLFAKHIKVQAQVKL HHHHHHCHHHHHHHH | 29967540 | ||
199 | Ubiquitination | IKVQAQVKLLEKRVV CHHHHHHHHHHCCEE | 23000965 | ||
203 | Ubiquitination | AQVKLLEKRVVHLGV HHHHHHHCCEEEECC | 23000965 | ||
212 | Phosphorylation | VVHLGVGTPGRIKEL EEEECCCCHHHHHHH | 20068231 | ||
217 | Ubiquitination | VGTPGRIKELVKQGG CCCHHHHHHHHHCCC | 23000965 | ||
221 | Ubiquitination | GRIKELVKQGGLNLS HHHHHHHHCCCCCCC | 23000965 | ||
228 | Phosphorylation | KQGGLNLSPLKFLVF HCCCCCCCCCEEEEE | 19664994 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CMS1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CMS1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CMS1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
S1PR1_HUMAN | S1PR1 | physical | 21988832 | |
GLYG_HUMAN | GYG1 | physical | 21988832 | |
PCDH7_HUMAN | PCDH7 | physical | 26186194 | |
PSME3_HUMAN | PSME3 | physical | 26186194 | |
MRGBP_HUMAN | MRGBP | physical | 26186194 | |
MDM2_HUMAN | MDM2 | physical | 26186194 | |
PCDH7_HUMAN | PCDH7 | physical | 28514442 | |
MDM2_HUMAN | MDM2 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...