| UniProt ID | S1PR1_HUMAN | |
|---|---|---|
| UniProt AC | P21453 | |
| Protein Name | Sphingosine 1-phosphate receptor 1 | |
| Gene Name | S1PR1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 382 | |
| Subcellular Localization |
Cell membrane Multi-pass membrane protein. Endosome. Membrane raft. Recruited to caveolin-enriched plasma membrane microdomains in response to oxidized 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine. Ligand binding leads to receptor internal |
|
| Protein Description | G-protein coupled receptor for the bioactive lysosphingolipid sphingosine 1-phosphate (S1P) that seems to be coupled to the G(i) subclass of heteromeric G proteins. Signaling leads to the activation of RAC1, SRC, PTK2/FAK1 and MAP kinases. Plays an important role in cell migration, probably via its role in the reorganization of the actin cytoskeleton and the formation of lamellipodia in response to stimuli that increase the activity of the sphingosine kinase SPHK1. Required for normal chemotaxis toward sphingosine 1-phosphate. Required for normal embryonic heart development and normal cardiac morphogenesis. Plays an important role in the regulation of sprouting angiogenesis and vascular maturation. Inhibits sprouting angiogenesis to prevent excessive sprouting during blood vessel development. Required for normal egress of mature T-cells from the thymus into the blood stream and into peripheral lymphoid organs. Plays a role in the migration of osteoclast precursor cells, the regulation of bone mineralization and bone homeostasis (By similarity). Plays a role in responses to oxidized 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine by pulmonary endothelial cells and in the protection against ventilator-induced lung injury.. | |
| Protein Sequence | MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | O-linked_Glycosylation | ----MGPTSVPLVKA ----CCCCCCCCCCC | 36.31 | 55828475 | |
| 5 | O-linked_Glycosylation | ---MGPTSVPLVKAH ---CCCCCCCCCCCC | 25.52 | 55828481 | |
| 10 | Acetylation | PTSVPLVKAHRSSVS CCCCCCCCCCCCCHH | 46.27 | - | |
| 14 | O-linked_Glycosylation | PLVKAHRSSVSDYVN CCCCCCCCCHHHHCC | 25.81 | OGP | |
| 30 | N-linked_Glycosylation | DIIVRHYNYTGKLNI EEEEEECCCCCCEEE | 23.05 | 12087059 | |
| 30 | N-linked_Glycosylation | DIIVRHYNYTGKLNI EEEEEECCCCCCEEE | 23.05 | 12087059 | |
| 36 | N-linked_Glycosylation | YNYTGKLNISADKEN CCCCCCEEECCCCCC | 29.65 | UniProtKB CARBOHYD | |
| 129 | Phosphorylation | GSMFVALSASVFSLL CCHHHHHHHHHHHHH | 14.57 | 22210691 | |
| 131 | Phosphorylation | MFVALSASVFSLLAI HHHHHHHHHHHHHHH | 21.96 | 22210691 | |
| 143 | Phosphorylation | LAIAIERYITMLKMK HHHHHHHHHHHHHHH | 6.48 | - | |
| 236 | Phosphorylation | RTRSRRLTFRKNISK HHHHHHHHHHHHHHH | 21.41 | 11583630 | |
| 328 | S-palmitoylation | AFIRIMSCCKCPSGD HHHHHHHCCCCCCCC | 1.10 | 19619245 | |
| 329 | S-palmitoylation | FIRIMSCCKCPSGDS HHHHHHCCCCCCCCC | 3.89 | 19619245 | |
| 330 | Acetylation | IRIMSCCKCPSGDSA HHHHHCCCCCCCCCC | 54.21 | 7427797 | |
| 331 | S-palmitoylation | RIMSCCKCPSGDSAG HHHHCCCCCCCCCCC | 1.70 | 19619245 | |
| 341 | Ubiquitination | GDSAGKFKRPIIAGM CCCCCCCCCCEEECC | 61.83 | - | |
| 351 | Phosphorylation | IIAGMEFSRSKSDNS EEECCEECCCCCCCC | 23.49 | 30266825 | |
| 353 | Phosphorylation | AGMEFSRSKSDNSSH ECCEECCCCCCCCCC | 35.00 | 23403867 | |
| 355 | Phosphorylation | MEFSRSKSDNSSHPQ CEECCCCCCCCCCCC | 43.18 | 23403867 | |
| 358 | Phosphorylation | SRSKSDNSSHPQKDE CCCCCCCCCCCCCCC | 34.71 | 26471730 | |
| 359 | Phosphorylation | RSKSDNSSHPQKDEG CCCCCCCCCCCCCCC | 45.50 | 23403867 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 236 | T | Phosphorylation | Kinase | AKT1 | P31749 | Uniprot |
| 236 | T | Phosphorylation | Kinase | AKT-FAMILY | - | GPS |
| 236 | T | Phosphorylation | Kinase | PKB_GROUP | - | PhosphoELM |
| Modified Location | Modified Residue | Modification | Function | Reference |
|---|---|---|---|---|
| 236 | T | Phosphorylation |
| 11583630 |
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
| 4 | O-linked Glycosylation | 13 (9) | R ⇒ S;G;C | rs41287280 |
| 27863252 |
| 5 | O-linked Glycosylation | 13 (8) | R ⇒ S;G;C | rs41287280 |
| 27863252 |
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| 5HT1A_HUMAN | HTR1A | physical | 11854302 | |
| PGFRB_HUMAN | PDGFRB | physical | 12480944 | |
| GNAI3_HUMAN | GNAI3 | physical | 8626678 | |
| GNAI1_HUMAN | GNAI1 | physical | 8626678 | |
| TRIP6_HUMAN | TRIP6 | physical | 19293149 | |
| WWP2_HUMAN | WWP2 | physical | 21555855 | |
| PPAL_HUMAN | ACP2 | physical | 28514442 | |
| AT2B3_HUMAN | ATP2B3 | physical | 28514442 | |
| HXK3_HUMAN | HK3 | physical | 28514442 | |
| SRC_HUMAN | SRC | physical | 28514442 | |
| GLP3L_HUMAN | GOLPH3L | physical | 28514442 | |
| GNAQ_HUMAN | GNAQ | physical | 28514442 | |
| AT12A_HUMAN | ATP12A | physical | 28514442 | |
| CD47_HUMAN | CD47 | physical | 28514442 | |
| ARL10_HUMAN | ARL10 | physical | 28514442 | |
| GBG5_HUMAN | GNG5 | physical | 28514442 | |
| RASH_HUMAN | HRAS | physical | 28514442 | |
| RAP2A_HUMAN | RAP2A | physical | 28514442 | |
| LMBR1_HUMAN | LMBR1 | physical | 28514442 | |
| TTYH3_HUMAN | TTYH3 | physical | 28514442 | |
| GNA13_HUMAN | GNA13 | physical | 28514442 | |
| AT1A3_HUMAN | ATP1A3 | physical | 28514442 | |
| GRIN1_HUMAN | GPRIN1 | physical | 28514442 | |
| POTEF_HUMAN | POTEF | physical | 28514442 |
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Akt-mediated phosphorylation of the G protein-coupled receptor EDG-1is required for endothelial cell chemotaxis."; Lee M.-J., Thangada S., Paik J.-H., Sapkota G.P., Ancellin N.,Chae S.-S., Wu M., Morales-Ruiz M., Sessa W.C., Alessi D.R., Hla T.; Mol. Cell 8:693-704(2001). Cited for: PHOSPHORYLATION AT THR-236, AND MUTAGENESIS OF THR-236. | |