UniProt ID | RAP2A_HUMAN | |
---|---|---|
UniProt AC | P10114 | |
Protein Name | Ras-related protein Rap-2a | |
Gene Name | RAP2A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 183 | |
Subcellular Localization |
Recycling endosome membrane Lipid-anchor Cytoplasmic side. Midbody. May also localize to the Golgi (PubMed:7962206) and the gelatinase-containing granules of neutrophils (PubMed:8391995). Colocalizes with RASGEF1B to midbody at telophase (PubMed:23 |
|
Protein Description | Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. In its active form interacts with and regulates several effectors including MAP4K4, MINK1 and TNIK. Part of a signaling complex composed of NEDD4, RAP2A and TNIK which regulates neuronal dendrite extension and arborization during development. More generally, it is part of several signaling cascades and may regulate cytoskeletal rearrangements, cell migration, cell adhesion and cell spreading.. | |
Protein Sequence | MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGCPFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MREYKVVVLGS ----CCEEEEEEECC | 9.94 | - | |
5 | Ubiquitination | ---MREYKVVVLGSG ---CCEEEEEEECCC | 24.65 | 23000965 | |
11 | Phosphorylation | YKVVVLGSGGVGKSA EEEEEECCCCCCCCC | 28.36 | 20068231 | |
17 | Phosphorylation | GSGGVGKSALTVQFV CCCCCCCCCEEEEEE | 23.68 | 20068231 | |
20 | Phosphorylation | GVGKSALTVQFVTGT CCCCCCEEEEEEEEC | 16.39 | 20068231 | |
25 | Phosphorylation | ALTVQFVTGTFIEKY CEEEEEEEECHHHHC | 31.62 | 20068231 | |
27 | Phosphorylation | TVQFVTGTFIEKYDP EEEEEEECHHHHCCC | 16.45 | 20068231 | |
31 | Ubiquitination | VTGTFIEKYDPTIED EEECHHHHCCCCHHH | 50.57 | 21987572 | |
35 | O-linked_Glycosylation | FIEKYDPTIEDFYRK HHHHCCCCHHHHHHC | 33.82 | 22267739 | |
40 | Phosphorylation | DPTIEDFYRKEIEVD CCCHHHHHHCCCCCC | 32.85 | - | |
42 | Ubiquitination | TIEDFYRKEIEVDSS CHHHHHHCCCCCCCC | 52.22 | 29901268 | |
48 | Phosphorylation | RKEIEVDSSPSVLEI HCCCCCCCCHHHHHH | 49.69 | 28060719 | |
49 | Phosphorylation | KEIEVDSSPSVLEIL CCCCCCCCHHHHHHH | 19.41 | 20068231 | |
51 | Phosphorylation | IEVDSSPSVLEILDT CCCCCCHHHHHHHHC | 41.08 | 20068231 | |
58 | Phosphorylation | SVLEILDTAGTEQFA HHHHHHHCCCCHHHH | 24.44 | 28060719 | |
61 | Phosphorylation | EILDTAGTEQFASMR HHHHCCCCHHHHHHH | 24.93 | 30108239 | |
66 | Phosphorylation | AGTEQFASMRDLYIK CCCHHHHHHHHEEEE | 18.68 | 30108239 | |
71 | Phosphorylation | FASMRDLYIKNGQGF HHHHHHEEEECCCEE | 17.71 | 28270605 | |
94 | Ubiquitination | QQSFQDIKPMRDQII CCCCCCCCCCHHHEE | 40.84 | 20159449PubMed | |
108 | Ubiquitination | IRVKRYEKVPVILVG EEEEECCCCCEEEEC | 42.79 | 29967540 | |
148 | Ubiquitination | PFMETSAKSKTMVDE CCCCCCCCCCHHHHH | 52.86 | 20159449PubMed | |
149 | Phosphorylation | FMETSAKSKTMVDEL CCCCCCCCCHHHHHH | 32.83 | 29978859 | |
150 | Ubiquitination | METSAKSKTMVDELF CCCCCCCCHHHHHHH | 39.68 | 20159449PubMed | |
151 | Phosphorylation | ETSAKSKTMVDELFA CCCCCCCHHHHHHHH | 29.53 | 29978859 | |
166 | Phosphorylation | EIVRQMNYAAQPDKD HHHHHCCCCCCCCCC | 9.66 | 29978859 | |
176 | S-palmitoylation | QPDKDDPCCSACNIQ CCCCCCCCCCCCCCC | 3.54 | 19061864 | |
177 | S-palmitoylation | PDKDDPCCSACNIQ- CCCCCCCCCCCCCC- | 3.34 | 19061864 | |
180 | Farnesylation | DDPCCSACNIQ---- CCCCCCCCCCC---- | 2.37 | 8424780 | |
180 | Methylation | DDPCCSACNIQ---- CCCCCCCCCCC---- | 2.37 | 8424780 | |
180 | Farnesylation | DDPCCSACNIQ---- CCCCCCCCCCC---- | 2.37 | 8424780 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAP2A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
63 | K | ubiquitylation |
| 20159449 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAP2A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RUN3A_HUMAN | RUNDC3A | physical | 9523700 | |
GNDS_HUMAN | RALGDS | physical | 10085114 | |
EF1A1_HUMAN | EEF1A1 | physical | 18624398 | |
PLMN_HUMAN | PLG | physical | 18624398 | |
FKBP2_HUMAN | FKBP2 | physical | 18624398 | |
U3IP2_HUMAN | RRP9 | physical | 18624398 | |
ERG24_HUMAN | TM7SF2 | physical | 18624398 | |
A1AT_HUMAN | SERPINA1 | physical | 18624398 | |
FRIL_HUMAN | FTL | physical | 18624398 | |
ENSA_HUMAN | ENSA | physical | 18624398 | |
TCPZ_HUMAN | CCT6A | physical | 26344197 | |
DX39A_HUMAN | DDX39A | physical | 26344197 | |
MTOR_HUMAN | MTOR | physical | 25446900 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...