UniProt ID | HXC13_HUMAN | |
---|---|---|
UniProt AC | P31276 | |
Protein Name | Homeobox protein Hox-C13 | |
Gene Name | HOXC13 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 330 | |
Subcellular Localization | Nucleus. | |
Protein Description | Transcription factor which plays a role in hair follicle differentiation. Regulates FOXQ1 expression and that of other hair-specific genes (By similarity).. | |
Protein Sequence | MTTSLLLHPRWPESLMYVYEDSAAESGIGGGGGGGGGGTGGAGGGCSGASPGKAPSMDGLGSSCPASHCRDLLPHPVLGRPPAPLGAPQGAVYTDIPAPEAARQCAPPPAPPTSSSATLGYGYPFGGSYYGCRLSHNVNLQQKPCAYHPGDKYPEPSGALPGDDLSSRAKEFAFYPSFASSYQAMPGYLDVSVVPGISGHPEPRHDALIPVEGYQHWALSNGWDSQVYCSKEQSQSAHLWKSPFPDVVPLQPEVSSYRRGRKKRVPYTKVQLKELEKEYAASKFITKEKRRRISATTNLSERQVTIWFQNRRVKEKKVVSKSKAPHLHST | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
143 | Acetylation | HNVNLQQKPCAYHPG CCCCCCCCCCCCCCC | 29.15 | 26051181 | |
225 | Phosphorylation | ALSNGWDSQVYCSKE HHHCCCCCEEEECHH | 18.29 | 24972180 | |
234 | Phosphorylation | VYCSKEQSQSAHLWK EEECHHHHHCCCCCC | 27.48 | 25159151 | |
236 | Phosphorylation | CSKEQSQSAHLWKSP ECHHHHHCCCCCCCC | 23.93 | 28348404 | |
241 | Ubiquitination | SQSAHLWKSPFPDVV HHCCCCCCCCCCCCC | 55.39 | 29967540 | |
273 | Ubiquitination | PYTKVQLKELEKEYA CCCHHHHHHHHHHHH | 43.07 | 29967540 | |
279 | Phosphorylation | LKELEKEYAASKFIT HHHHHHHHHHHHHCC | 20.66 | 27811184 | |
282 | Phosphorylation | LEKEYAASKFITKEK HHHHHHHHHHCCHHH | 21.67 | 27811184 | |
286 | Phosphorylation | YAASKFITKEKRRRI HHHHHHCCHHHHHHC | 35.96 | 27811184 | |
294 | Phosphorylation | KEKRRRISATTNLSE HHHHHHCCCCCCCCH | 20.11 | - | |
296 | Phosphorylation | KRRRISATTNLSERQ HHHHCCCCCCCCHHH | 14.93 | - | |
300 | Phosphorylation | ISATTNLSERQVTIW CCCCCCCCHHHEEEE | 32.57 | - | |
330 | Phosphorylation | KAPHLHST------- CCCCCCCC------- | 31.70 | 28348404 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HXC13_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HXC13_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HXC13_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NR2E3_HUMAN | NR2E3 | physical | 20211142 | |
RHXF2_HUMAN | RHOXF2 | physical | 20211142 | |
ELF1_HUMAN | ELF1 | physical | 18692240 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...