dbPTM

NR2E3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NR2E3_HUMAN
UniProt AC	Q9Y5X4
Protein Name	Photoreceptor-specific nuclear receptor
Gene Name	NR2E3
Organism	Homo sapiens (Human).
Sequence Length	410
Subcellular Localization	Nucleus .
Protein Description	Orphan nuclear receptor of retinal photoreceptor cells. Transcriptional factor that is an activator of rod development and repressor of cone development. Binds the promoter region of a number of rod- and cone-specific genes, including rhodopsin, M- and S-opsin and rod-specific phosphodiesterase beta subunit. Enhances rhodopsin expression. Represses M- and S-cone opsin expression..
Protein Sequence	METRPTALMSSTVAAAAPAAGAASRKESPGRWGLGEDPTGVSPSLQCRVCGDSSSGKHYGIYACNGCSGFFKRSVRRRLIYRCQVGAGMCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQVHLDSMESNTESRPESLVAPPAPAGRSPRGPTPMSAARALGHHFMASLITAETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPCGLDSIHETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPPEASAAGGAQGRLTLASMETRVLQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELLFFRKTIGNTPMEKLLCDMFKN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--METRPTALMSSTV --CCCCCCHHHHHHH	29.18	22210691
11	Phosphorylation	RPTALMSSTVAAAAP CCCHHHHHHHHHHHC	16.97	-
12	Phosphorylation	PTALMSSTVAAAAPA CCHHHHHHHHHHHCC	13.57	22210691
24	Phosphorylation	APAAGAASRKESPGR HCCCCHHCCCCCCCC	43.27	22210691
81	Phosphorylation	SVRRRLIYRCQVGAG HHHHHHHHHCCCCCC	15.21	-
145	Phosphorylation	NTESRPESLVAPPAP CCCCCCHHHCCCCCC	30.72	23898821
156	Phosphorylation	PPAPAGRSPRGPTPM CCCCCCCCCCCCCCH	20.31	23898821
333	Phosphorylation	LVLFKPETRGLKDPE HHHCCCCCCCCCCHH	38.27	17081983
377	Phosphorylation	KLLLLLPSLRFITAE HHHHHHHHHHHHCHH	31.95	24719451
394	Phosphorylation	ELLFFRKTIGNTPME HHHHHHCCCCCCCHH	29.84	22985185

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of NR2E3_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
185	K	Sumoylation		-
Sumoylation on Lys-185 appears to be the main site (By similarity).

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NR2E3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RARA_HUMAN	RARA	physical	10611353
RXRA_HUMAN	RXRA	physical	10611353
IRF9_HUMAN	IRF9	physical	20211142
RFOX2_HUMAN	RBFOX2	physical	20211142
DEDD2_HUMAN	DEDD2	physical	20211142
BC11A_HUMAN	BCL11A	physical	23975195
NR2E3_HUMAN	NR2E3	physical	25703721
NR1D1_HUMAN	NR1D1	physical	25703721
CRX_HUMAN	CRX	physical	25703721
NRL_HUMAN	NRL	physical	25703721

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
268100	Enhanced S cone syndrome (ESCS)
611131	Retinitis pigmentosa 37 (RP37)
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NR2E3_HUMAN

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Global, in vivo, and site-specific phosphorylation dynamics insignaling networks."; Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.; Cell 127:635-648(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-333, AND MASSSPECTROMETRY.	17081983 [Abstract]