UniProt ID | NRL_HUMAN | |
---|---|---|
UniProt AC | P54845 | |
Protein Name | Neural retina-specific leucine zipper protein | |
Gene Name | NRL | |
Organism | Homo sapiens (Human). | |
Sequence Length | 237 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Acts as a transcriptional activator which regulates the expression of several rod-specific genes, including RHO and PDE6B. [PubMed: 21981118 Functions also as a transcriptional coactivator, stimulating transcription mediated by the transcription factor CRX and NR2E3] | |
Protein Sequence | MALPPSPLAMEYVNDFDLMKFEVKREPSEGRPGPPTASLGSTPYSSVPPSPTFSEPGMVGATEGTRPGLEELYWLATLQQQLGAGEALGLSPEEAMELLQGQGPVPVDGPHGYYPGSPEETGAQHVQLAERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGSGDPSHLFL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
20 | Sumoylation | VNDFDLMKFEVKREP CCHHHCEEEEEECCC | 45.75 | - | |
20 | Sumoylation | VNDFDLMKFEVKREP CCHHHCEEEEEECCC | 45.75 | - | |
24 | Sumoylation | DLMKFEVKREPSEGR HCEEEEEECCCCCCC | 43.79 | - | |
36 | Phosphorylation | EGRPGPPTASLGSTP CCCCCCCCCCCCCCC | 31.82 | - | |
50 | Phosphorylation | PYSSVPPSPTFSEPG CCCCCCCCCCCCCCC | 30.42 | 17335001 | |
52 | Phosphorylation | SSVPPSPTFSEPGMV CCCCCCCCCCCCCCC | 44.10 | - | |
54 | Phosphorylation | VPPSPTFSEPGMVGA CCCCCCCCCCCCCCC | 45.41 | 22210691 | |
62 | Phosphorylation | EPGMVGATEGTRPGL CCCCCCCCCCCCCCH | 29.08 | 22210691 | |
65 | Phosphorylation | MVGATEGTRPGLEEL CCCCCCCCCCCHHHH | 27.71 | 22210691 | |
229 | Phosphorylation | LTSSGPGSGDPSHLF HCCCCCCCCCHHHCC | 43.06 | 23532336 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NRL_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
20 | K | Sumoylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NRL_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FIZ1_HUMAN | FIZ1 | physical | 12566383 | |
CRX_BOVIN | CRX | physical | 10887186 | |
OPTN_HUMAN | OPTN | physical | 23956131 | |
NR2E3_HUMAN | NR2E3 | physical | 25703721 |
loading...