| UniProt ID | F167A_HUMAN | |
|---|---|---|
| UniProt AC | Q96KS9 | |
| Protein Name | Protein FAM167A | |
| Gene Name | FAM167A | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 214 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MSVPQIHVEEVGAEEGAGAAAPPDDHLRSLKALTEKLRLETRRPSYLEWQARLEEHTWPFPRPAAEPQASLEEGERGGQEPLLPLREAGQHPPSARSASQGARPLSTGKLEGFQSIDEAIAWLRKELTEMRLQDQQLARQLMRLRGDINKLKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTPLKLIGVTKMNINSRRFSLC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSVPQIHVE ------CCCCCEEEE | 42.37 | 24719451 | |
| 41 | Phosphorylation | TEKLRLETRRPSYLE HHHHHHHHCCCHHHH | 36.25 | 26074081 | |
| 45 | Phosphorylation | RLETRRPSYLEWQAR HHHHCCCHHHHHHHH | 40.30 | 26074081 | |
| 46 | Phosphorylation | LETRRPSYLEWQARL HHHCCCHHHHHHHHH | 16.01 | 26074081 | |
| 99 | Phosphorylation | PPSARSASQGARPLS CCCHHHHCCCCCCCC | 30.32 | 23898821 | |
| 106 | Phosphorylation | SQGARPLSTGKLEGF CCCCCCCCCCCCCCC | 37.48 | 27732954 | |
| 107 | Phosphorylation | QGARPLSTGKLEGFQ CCCCCCCCCCCCCCC | 46.12 | 27732954 | |
| 115 | Phosphorylation | GKLEGFQSIDEAIAW CCCCCCCCHHHHHHH | 29.73 | 30576142 | |
| 145 | Dimethylation | ARQLMRLRGDINKLK HHHHHHHHCCHHHHH | 30.30 | - | |
| 169 | Phosphorylation | RMLNDATYELEERDE HHHHCCCEEHHHHHH | 21.90 | 27642862 | |
| 208 | Phosphorylation | VTKMNINSRRFSLC- EEECCCCCCCCCCC- | 22.49 | 29514088 | |
| 212 | Phosphorylation | NINSRRFSLC----- CCCCCCCCCC----- | 27.32 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of F167A_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of F167A_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of F167A_HUMAN !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...