UniProt ID | COMD8_HUMAN | |
---|---|---|
UniProt AC | Q9NX08 | |
Protein Name | COMM domain-containing protein 8 | |
Gene Name | COMMD8 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 183 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes. [PubMed: 21778237 May down-regulate activation of NF-kappa-B] | |
Protein Sequence | MEPEEGTPLWRLQKLPAELGPQLLHKIIDGICGRAYPVYQDYHTVWESEEWMHVLEDIAKFFKAIVGKNLPDEEIFQQLNQLNSLHQETIMKCVKSRKDEIKQALSREIVAISSAQLQDFDWQVKLALSSDKIAALRMPLLSLHLDVKENGEVKPYSIEMSREELQNLIQSLEAANKVVLQLK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Phosphorylation | -MEPEEGTPLWRLQK -CCCCCCCCCCHHCC | 20.63 | 20068231 | |
14 | Ubiquitination | TPLWRLQKLPAELGP CCCCHHCCCCHHHCH | 62.11 | 29967540 | |
52 | Sulfoxidation | VWESEEWMHVLEDIA HHCCHHHHHHHHHHH | 1.45 | 30846556 | |
68 | Ubiquitination | FFKAIVGKNLPDEEI HHHHHHCCCCCHHHH | 44.40 | 29967540 | |
92 | Ubiquitination | LHQETIMKCVKSRKD HCHHHHHHHHHCCHH | 31.83 | 29967540 | |
102 | Ubiquitination | KSRKDEIKQALSREI HCCHHHHHHHHHHHH | 27.72 | 24816145 | |
130 | Ubiquitination | QVKLALSSDKIAALR HHHHHHCCCHHHHHH | 43.72 | 21890473 | |
132 | Ubiquitination | KLALSSDKIAALRMP HHHHCCCHHHHHHHH | 35.87 | 23000965 | |
132 | 2-Hydroxyisobutyrylation | KLALSSDKIAALRMP HHHHCCCHHHHHHHH | 35.87 | - | |
132 | Acetylation | KLALSSDKIAALRMP HHHHCCCHHHHHHHH | 35.87 | 25953088 | |
152 | Ubiquitination | LDVKENGEVKPYSIE EEECCCCEECCEEEE | 59.97 | 29967540 | |
154 | Ubiquitination | VKENGEVKPYSIEMS ECCCCEECCEEEEEC | 33.66 | 29967540 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COMD8_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COMD8_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COMD8_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...