| UniProt ID | COMD3_HUMAN | |
|---|---|---|
| UniProt AC | Q9UBI1 | |
| Protein Name | COMM domain-containing protein 3 | |
| Gene Name | COMMD3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 195 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes. [PubMed: 21778237 May down-regulate activation of NF-kappa-B] | |
| Protein Sequence | MELSESVQKGFQMLADPRSFDSNAFTLLLRAAFQSLLDAQADEAVLDHPDLKHIDPVVLKHCHAAAATYILEAGKHRADKSTLSTYLEDCKFDRERIELFCTEYQNNKNSLEILLGSIGRSLPHITDVSWRLEYQIKTNQLHRMYRPAYLVTLSVQNTDSPSYPEISFSCSMEQLQDLVGKLKDASKSLERATQL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MELSESVQ -------CCHHHHHH | 12.03 | - | |
| 1 | Sulfoxidation | -------MELSESVQ -------CCHHHHHH | 12.03 | 28465586 | |
| 6 | Phosphorylation | --MELSESVQKGFQM --CCHHHHHHHHHHH | 26.86 | 28857561 | |
| 9 | Ubiquitination | ELSESVQKGFQMLAD CHHHHHHHHHHHHCC | 60.58 | - | |
| 52 | Ubiquitination | VLDHPDLKHIDPVVL HHCCCCCCCCCHHHH | 45.99 | 21963094 | |
| 60 | Ubiquitination | HIDPVVLKHCHAAAA CCCHHHHHHHHHHHH | 32.35 | 29967540 | |
| 68 | Phosphorylation | HCHAAAATYILEAGK HHHHHHHHHHHHCCC | 13.33 | 20068231 | |
| 75 | Ubiquitination | TYILEAGKHRADKST HHHHHCCCCCCCHHH | 36.64 | - | |
| 80 | Ubiquitination | AGKHRADKSTLSTYL CCCCCCCHHHHHHHH | 44.34 | 29967540 | |
| 91 | Ubiquitination | STYLEDCKFDRERIE HHHHHHCCCCHHHHH | 63.72 | 24816145 | |
| 108 | Ubiquitination | CTEYQNNKNSLEILL HHHHHCCCCCHHHHH | 56.30 | 21906983 | |
| 126 | Phosphorylation | GRSLPHITDVSWRLE HCCCCCCCCCCHHEE | 27.58 | - | |
| 137 | Ubiquitination | WRLEYQIKTNQLHRM HHEEEEEHHCCCHHE | 26.37 | 21890473 | |
| 137 | Methylation | WRLEYQIKTNQLHRM HHEEEEEHHCCCHHE | 26.37 | - | |
| 137 | Malonylation | WRLEYQIKTNQLHRM HHEEEEEHHCCCHHE | 26.37 | 32601280 | |
| 183 | Ubiquitination | QDLVGKLKDASKSLE HHHHHHHHHHHHHHH | 55.52 | - | |
| 186 | Phosphorylation | VGKLKDASKSLERAT HHHHHHHHHHHHHHH | 32.67 | 22468782 | |
| 187 | Ubiquitination | GKLKDASKSLERATQ HHHHHHHHHHHHHHC | 61.86 | 29967540 | |
| 188 | Phosphorylation | KLKDASKSLERATQL HHHHHHHHHHHHHCC | 32.73 | 22468782 | |
| 193 | Phosphorylation | SKSLERATQL----- HHHHHHHHCC----- | 36.30 | 22468782 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COMD3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COMD3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COMD3_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, AND MASS SPECTROMETRY. | |
