UniProt ID | COMD3_HUMAN | |
---|---|---|
UniProt AC | Q9UBI1 | |
Protein Name | COMM domain-containing protein 3 | |
Gene Name | COMMD3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 195 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes. [PubMed: 21778237 May down-regulate activation of NF-kappa-B] | |
Protein Sequence | MELSESVQKGFQMLADPRSFDSNAFTLLLRAAFQSLLDAQADEAVLDHPDLKHIDPVVLKHCHAAAATYILEAGKHRADKSTLSTYLEDCKFDRERIELFCTEYQNNKNSLEILLGSIGRSLPHITDVSWRLEYQIKTNQLHRMYRPAYLVTLSVQNTDSPSYPEISFSCSMEQLQDLVGKLKDASKSLERATQL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MELSESVQ -------CCHHHHHH | 12.03 | - | |
1 | Sulfoxidation | -------MELSESVQ -------CCHHHHHH | 12.03 | 28465586 | |
6 | Phosphorylation | --MELSESVQKGFQM --CCHHHHHHHHHHH | 26.86 | 28857561 | |
9 | Ubiquitination | ELSESVQKGFQMLAD CHHHHHHHHHHHHCC | 60.58 | - | |
52 | Ubiquitination | VLDHPDLKHIDPVVL HHCCCCCCCCCHHHH | 45.99 | 21963094 | |
60 | Ubiquitination | HIDPVVLKHCHAAAA CCCHHHHHHHHHHHH | 32.35 | 29967540 | |
68 | Phosphorylation | HCHAAAATYILEAGK HHHHHHHHHHHHCCC | 13.33 | 20068231 | |
75 | Ubiquitination | TYILEAGKHRADKST HHHHHCCCCCCCHHH | 36.64 | - | |
80 | Ubiquitination | AGKHRADKSTLSTYL CCCCCCCHHHHHHHH | 44.34 | 29967540 | |
91 | Ubiquitination | STYLEDCKFDRERIE HHHHHHCCCCHHHHH | 63.72 | 24816145 | |
108 | Ubiquitination | CTEYQNNKNSLEILL HHHHHCCCCCHHHHH | 56.30 | 21906983 | |
126 | Phosphorylation | GRSLPHITDVSWRLE HCCCCCCCCCCHHEE | 27.58 | - | |
137 | Ubiquitination | WRLEYQIKTNQLHRM HHEEEEEHHCCCHHE | 26.37 | 21890473 | |
137 | Methylation | WRLEYQIKTNQLHRM HHEEEEEHHCCCHHE | 26.37 | - | |
137 | Malonylation | WRLEYQIKTNQLHRM HHEEEEEHHCCCHHE | 26.37 | 32601280 | |
183 | Ubiquitination | QDLVGKLKDASKSLE HHHHHHHHHHHHHHH | 55.52 | - | |
186 | Phosphorylation | VGKLKDASKSLERAT HHHHHHHHHHHHHHH | 32.67 | 22468782 | |
187 | Ubiquitination | GKLKDASKSLERATQ HHHHHHHHHHHHHHC | 61.86 | 29967540 | |
188 | Phosphorylation | KLKDASKSLERATQL HHHHHHHHHHHHHCC | 32.73 | 22468782 | |
193 | Phosphorylation | SKSLERATQL----- HHHHHHHHCC----- | 36.30 | 22468782 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COMD3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COMD3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COMD3_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, AND MASS SPECTROMETRY. |