UniProt ID | COMD6_HUMAN | |
---|---|---|
UniProt AC | Q7Z4G1 | |
Protein Name | COMM domain-containing protein 6 | |
Gene Name | COMMD6 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 85 | |
Subcellular Localization | Nucleus . Cytoplasm . | |
Protein Description | May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes. [PubMed: 21778237 Down-regulates activation of NF-kappa-B. Inhibits TNF-induced NFKB1 activation.] | |
Protein Sequence | MEASSEPPLDAKSDVTNQLVDFQWKLGMAVSSDTCRSLKYPYVAVMLKVADHSGQVKTKCFEMTIPQFQNFYRQFKEIAAVIETV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MEASSEPP -------CCCCCCCC | 9.78 | 19413330 | |
12 | Ubiquitination | SEPPLDAKSDVTNQL CCCCCCCCCHHHHHH | 47.02 | 23000965 | |
28 | Sulfoxidation | DFQWKLGMAVSSDTC HHHHHHCCCCCCHHH | 4.89 | 21406390 | |
31 | Phosphorylation | WKLGMAVSSDTCRSL HHHCCCCCCHHHHHC | 16.98 | 27251275 | |
32 (in isoform 2) | Phosphorylation | - | 30.27 | 27251275 | |
32 | Phosphorylation | KLGMAVSSDTCRSLK HHCCCCCCHHHHHCC | 30.27 | 27251275 | |
39 | Acetylation | SDTCRSLKYPYVAVM CHHHHHCCCCEEEEE | 45.48 | 20167786 | |
39 | Ubiquitination | SDTCRSLKYPYVAVM CHHHHHCCCCEEEEE | 45.48 | 23000965 | |
39 (in isoform 2) | Ubiquitination | - | 45.48 | 21890473 | |
39 (in isoform 1) | Ubiquitination | - | 45.48 | 21890473 | |
48 | Acetylation | PYVAVMLKVADHSGQ CEEEEEEEECCCCCC | 19.79 | 20167786 | |
57 | Acetylation | ADHSGQVKTKCFEMT CCCCCCEEEEEEEEE | 34.09 | 25953088 | |
72 | Phosphorylation | IPQFQNFYRQFKEIA HHHHHHHHHHHHHHH | 15.85 | 30257219 | |
79 | Ubiquitination | YRQFKEIAAVIETV- HHHHHHHHHHEECC- | 9.21 | 21890473 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COMD6_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COMD6_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COMD6_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, AND MASS SPECTROMETRY. |