UniProt ID | NOL12_HUMAN | |
---|---|---|
UniProt AC | Q9UGY1 | |
Protein Name | Nucleolar protein 12 | |
Gene Name | NOL12 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 213 | |
Subcellular Localization | Nucleus, nucleolus. | |
Protein Description | May bind to 28S rRNA.. | |
Protein Sequence | MGRNKKKKRDGDDRRPRLVLSFDEEKRREYLTGFHKRKVERKKAAIEEIKQRLKEEQRKLREERHQEYLKMLAEREEALEEADELDRLVTAKTESVQYDHPNHTVTVTTISDLDLSGARLLGLTPPEGGAGDRSEEEASSTEKPTKALPRKSRDPLLSQRISSLTASLHAHSRKKVKRKHPRRAQDSKKPPRAPRTSKAQRRRLTGKARHSGE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
21 | Phosphorylation | RRPRLVLSFDEEKRR CCCCEEEECCHHHHH | 24.15 | 29449344 | |
50 | Ubiquitination | KAAIEEIKQRLKEEQ HHHHHHHHHHHHHHH | 32.42 | - | |
75 | Methylation | YLKMLAEREEALEEA HHHHHHHHHHHHHHH | 41.26 | 115483217 | |
98 | Phosphorylation | AKTESVQYDHPNHTV HEEECCCCCCCCCEE | 17.67 | 27642862 | |
108 | Phosphorylation | PNHTVTVTTISDLDL CCCEEEEEEEECCCC | 14.73 | 28122231 | |
109 | Phosphorylation | NHTVTVTTISDLDLS CCEEEEEEEECCCCC | 17.72 | 28122231 | |
111 | Phosphorylation | TVTVTTISDLDLSGA EEEEEEEECCCCCCC | 29.99 | 28122231 | |
116 | Phosphorylation | TISDLDLSGARLLGL EEECCCCCCCEECCC | 30.03 | 29496963 | |
124 | Phosphorylation | GARLLGLTPPEGGAG CCEECCCCCCCCCCC | 34.69 | 29255136 | |
134 | Phosphorylation | EGGAGDRSEEEASST CCCCCCCCHHHHHCC | 54.84 | 29255136 | |
139 | Phosphorylation | DRSEEEASSTEKPTK CCCHHHHHCCCCCCC | 40.86 | 23401153 | |
140 | Phosphorylation | RSEEEASSTEKPTKA CCHHHHHCCCCCCCC | 47.86 | 23401153 | |
141 | Phosphorylation | SEEEASSTEKPTKAL CHHHHHCCCCCCCCC | 45.60 | 22167270 | |
145 | Phosphorylation | ASSTEKPTKALPRKS HHCCCCCCCCCCCCC | 39.76 | 23401153 | |
152 | Phosphorylation | TKALPRKSRDPLLSQ CCCCCCCCCCHHHHH | 43.10 | 28555341 | |
158 | Phosphorylation | KSRDPLLSQRISSLT CCCCHHHHHHHHHHH | 25.70 | 24719451 | |
162 | Phosphorylation | PLLSQRISSLTASLH HHHHHHHHHHHHHHH | 22.83 | 20068231 | |
163 | Phosphorylation | LLSQRISSLTASLHA HHHHHHHHHHHHHHH | 27.63 | 20068231 | |
165 | Phosphorylation | SQRISSLTASLHAHS HHHHHHHHHHHHHHH | 19.02 | 28555341 | |
167 | Phosphorylation | RISSLTASLHAHSRK HHHHHHHHHHHHHHH | 18.56 | 20068231 | |
172 | Phosphorylation | TASLHAHSRKKVKRK HHHHHHHHHHHHHHH | 46.72 | 21712546 | |
187 | Phosphorylation | HPRRAQDSKKPPRAP CCCCCCCCCCCCCCC | 30.42 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NOL12_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NOL12_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NOL12_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Global, in vivo, and site-specific phosphorylation dynamics insignaling networks."; Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.; Cell 127:635-648(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-139; SER-140 ANDTHR-141, AND MASS SPECTROMETRY. | |
"Phosphoproteome analysis of the human mitotic spindle."; Nousiainen M., Sillje H.H.W., Sauer G., Nigg E.A., Koerner R.; Proc. Natl. Acad. Sci. U.S.A. 103:5391-5396(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-124, AND MASSSPECTROMETRY. |