| UniProt ID | NHP2_HUMAN | |
|---|---|---|
| UniProt AC | Q9NX24 | |
| Protein Name | H/ACA ribonucleoprotein complex subunit 2 | |
| Gene Name | NHP2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 153 | |
| Subcellular Localization | Nucleus, nucleolus. Nucleus, Cajal body. Also localized to Cajal bodies (coiled bodies). | |
| Protein Description | Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Each rRNA can contain up to 100 pseudouridine ("psi") residues, which may serve to stabilize the conformation of rRNAs. May also be required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme.. | |
| Protein Sequence | MTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLPLPL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Sumoylation | -----MTKIKADPDG -----CCCCCCCCCC | 40.69 | 28112733 | |
| 5 | Sumoylation | ---MTKIKADPDGPE ---CCCCCCCCCCHH | 48.57 | - | |
| 5 | Ubiquitination | ---MTKIKADPDGPE ---CCCCCCCCCCHH | 48.57 | - | |
| 5 | Acetylation | ---MTKIKADPDGPE ---CCCCCCCCCCHH | 48.57 | 23749302 | |
| 5 | Sumoylation | ---MTKIKADPDGPE ---CCCCCCCCCCHH | 48.57 | 25114211 | |
| 18 | Glutathionylation | PEAQAEACSGERTYQ HHHHHHHHCCCCCHH | 3.95 | 22555962 | |
| 19 | Phosphorylation | EAQAEACSGERTYQE HHHHHHHCCCCCHHH | 51.22 | 18523010 | |
| 23 | Phosphorylation | EACSGERTYQELLVN HHHCCCCCHHHHHHC | 25.84 | 29978859 | |
| 24 | Phosphorylation | ACSGERTYQELLVNQ HHCCCCCHHHHHHCC | 13.25 | 24043423 | |
| 48 | Phosphorylation | RRLTRKLYKCIKKAV HHHHHHHHHHHHHHH | 13.57 | - | |
| 49 | Acetylation | RLTRKLYKCIKKAVK HHHHHHHHHHHHHHH | 39.66 | 25953088 | |
| 56 | Methylation | KCIKKAVKQKQIRRG HHHHHHHHHHHHHHH | 57.55 | 23748837 | |
| 69 | Ubiquitination | RGVKEVQKFVNKGEK HHHHHHHHHHHCCCC | 57.36 | - | |
| 73 | Ubiquitination | EVQKFVNKGEKGIMV HHHHHHHCCCCCEEE | 64.24 | - | |
| 91 | Phosphorylation | DTLPIEVYCHLPVMC CCCCEEEEECCCEEE | 2.14 | 27642862 | |
| 105 | Phosphorylation | CEDRNLPYVYIPSKT ECCCCCCEEEECCCC | 14.73 | 28796482 | |
| 107 | Phosphorylation | DRNLPYVYIPSKTDL CCCCCEEEECCCCCC | 10.98 | 28796482 | |
| 110 | Phosphorylation | LPYVYIPSKTDLGAA CCEEEECCCCCCCCC | 38.33 | 24719451 | |
| 111 | Acetylation | PYVYIPSKTDLGAAA CEEEECCCCCCCCCC | 40.48 | 25953088 | |
| 111 | Ubiquitination | PYVYIPSKTDLGAAA CEEEECCCCCCCCCC | 40.48 | - | |
| 112 | Phosphorylation | YVYIPSKTDLGAAAG EEEECCCCCCCCCCC | 40.57 | 21406692 | |
| 120 | Phosphorylation | DLGAAAGSKRPTCVI CCCCCCCCCCCEEEE | 22.29 | 21406692 | |
| 121 | 2-Hydroxyisobutyrylation | LGAAAGSKRPTCVIM CCCCCCCCCCEEEEE | 62.57 | - | |
| 121 | Ubiquitination | LGAAAGSKRPTCVIM CCCCCCCCCCEEEEE | 62.57 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NHP2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NHP2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NHP2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| NOP58_HUMAN | NOP58 | physical | 22939629 | |
| JMJD6_HUMAN | JMJD6 | physical | 23455924 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 613987 | Dyskeratosis congenita, autosomal recessive, 2 (DKCB2) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...