| UniProt ID | FLOT2_MOUSE | |
|---|---|---|
| UniProt AC | Q60634 | |
| Protein Name | Flotillin-2 | |
| Gene Name | Flot2 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 428 | |
| Subcellular Localization |
Cell membrane Peripheral membrane protein. Membrane, caveola Peripheral membrane protein . Endosome. Membrane Lipid-anchor . Membrane-associated protein of caveolae.. |
|
| Protein Description | May act as a scaffolding protein within caveolar membranes, functionally participating in formation of caveolae or caveolae-like vesicles. May be involved in epidermal cell adhesion and epidermal structure and function.. | |
| Protein Sequence | MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKISAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKNATGAQV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Myristoylation | ------MGNCHTVGP ------CCCCCCCCC | 45.53 | - | |
| 4 | S-palmitoylation | ----MGNCHTVGPNE ----CCCCCCCCCCC | 2.05 | - | |
| 19 | S-palmitoylation | ALVVSGGCCGSDYKQ EEEEECCCCCCCHHH | 2.44 | - | |
| 20 | S-palmitoylation | LVVSGGCCGSDYKQY EEEECCCCCCCHHHH | 7.08 | - | |
| 88 | S-palmitoylation | KELLAVACEQFLGKN HHHHHHHHHHHCCCC | 3.20 | 28526873 | |
| 100 | Ubiquitination | GKNVQDIKNVVLQTL CCCHHHHHHHHHHHH | 52.56 | - | |
| 160 | Ubiquitination | TIKDVYDKVDYLSSL EHHHHHHHHHHHHHC | 21.22 | - | |
| 169 | Ubiquitination | DYLSSLGKTQTAVVQ HHHHHCCCCEEEEHH | 42.63 | - | |
| 210 | Phosphorylation | DVKFMADTKIADSKR CCCHHCCCCCCCHHH | 18.14 | 28059163 | |
| 215 | Phosphorylation | ADTKIADSKRAFELQ CCCCCCCHHHHHHHH | 18.28 | 28059163 | |
| 227 | Phosphorylation | ELQKSAFSEEVNIKT HHHHHHCCCCCCHHH | 32.34 | 29899451 | |
| 241 | Phosphorylation | TAEAQLAYELQGARE HHHHHHHHHHHCHHH | 26.26 | 25159016 | |
| 348 | Phosphorylation | MKLKAEAYQKYGDAA HHHHHHHHHHHHHHH | 9.31 | 24759943 | |
| 350 | Ubiquitination | LKAEAYQKYGDAAKM HHHHHHHHHHHHHHH | 38.23 | - | |
| 370 | Ubiquitination | ALPQIAAKISAPLTK HHHHHHHHCCCCCCC | 28.33 | - | |
| 390 | Ubiquitination | VLSGDNSKVTSEVNR EECCCCCHHHHHHHH | 56.65 | - | |
| 405 | Phosphorylation | LLAELPASVHALTGV HHHHCCCCHHHHCCC | 16.70 | - | |
| 416 | Ubiquitination | LTGVDLSKIPLIKNA HCCCCHHHCCCCCCC | 56.49 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FLOT2_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FLOT2_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FLOT2_MOUSE !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
