UniProt ID | ATOH1_HUMAN | |
---|---|---|
UniProt AC | Q92858 | |
Protein Name | Protein atonal homolog 1 | |
Gene Name | ATOH1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 354 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcriptional regulator. Activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. Plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription (By similarity).. | |
Protein Sequence | MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPSGGEQPPPPPASCKSDHHHLRTAASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
49 | Phosphorylation | QAREHPVYPPELSLL EECCCCCCCCCHHCC | 19.95 | 26657352 | |
58 | Phosphorylation | PELSLLDSTDPRAWL CCHHCCCCCCCCHHH | 34.38 | 26657352 | |
59 | Phosphorylation | ELSLLDSTDPRAWLA CHHCCCCCCCCHHHH | 50.09 | 26657352 | |
80 | Phosphorylation | CTARAAQYLLHSPEL HHHHHHHHHHHCCCC | 13.40 | 23312004 | |
84 | Phosphorylation | AAQYLLHSPELGASE HHHHHHHCCCCCCCC | 21.75 | 23312004 | |
150 | Phosphorylation | SRQRAPSSKQVNGVQ CCCCCCCCHHCCHHH | 26.50 | - | |
345 | Phosphorylation | DGEFSPHSHYSDSDE CCCCCCCCCCCCCCC | 27.75 | - | |
347 | Phosphorylation | EFSPHSHYSDSDEAS CCCCCCCCCCCCCCC | 19.72 | - |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATOH1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATOH1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...