| UniProt ID | ATOH1_HUMAN | |
|---|---|---|
| UniProt AC | Q92858 | |
| Protein Name | Protein atonal homolog 1 | |
| Gene Name | ATOH1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 354 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Transcriptional regulator. Activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. Plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription (By similarity).. | |
| Protein Sequence | MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPSGGEQPPPPPASCKSDHHHLRTAASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 49 | Phosphorylation | QAREHPVYPPELSLL EECCCCCCCCCHHCC | 19.95 | 26657352 | |
| 58 | Phosphorylation | PELSLLDSTDPRAWL CCHHCCCCCCCCHHH | 34.38 | 26657352 | |
| 59 | Phosphorylation | ELSLLDSTDPRAWLA CHHCCCCCCCCHHHH | 50.09 | 26657352 | |
| 80 | Phosphorylation | CTARAAQYLLHSPEL HHHHHHHHHHHCCCC | 13.40 | 23312004 | |
| 84 | Phosphorylation | AAQYLLHSPELGASE HHHHHHHCCCCCCCC | 21.75 | 23312004 | |
| 150 | Phosphorylation | SRQRAPSSKQVNGVQ CCCCCCCCHHCCHHH | 26.50 | - | |
| 345 | Phosphorylation | DGEFSPHSHYSDSDE CCCCCCCCCCCCCCC | 27.75 | - | |
| 347 | Phosphorylation | EFSPHSHYSDSDEAS CCCCCCCCCCCCCCC | 19.72 | - |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATOH1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATOH1_HUMAN !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...