UniProt ID | SML1_YEAST | |
---|---|---|
UniProt AC | Q04964 | |
Protein Name | Ribonucleotide reductase inhibitor protein SML1 | |
Gene Name | SML1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 104 | |
Subcellular Localization | Nucleus . Cytoplasm . | |
Protein Description | Strong inhibitor of ribonucleotide reductase (RNR1) and is involved in regulating dNTP production.. | |
Protein Sequence | MQNSQDYFYAQNRCQQQQAPSTLRTVTMAEFRRVPLPPMAEVPMLSTQNSMGSSASASASSLEMWEKDLEERLNSIDHDMNNNKFGSGELKSMFNQGKVEEMDF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MQNSQDYF -------CCCHHHHH | 8.42 | 22814378 | |
27 | Phosphorylation | PSTLRTVTMAEFRRV CCCCCEEEHHHHCCC | 15.28 | 27017623 | |
56 | Phosphorylation | NSMGSSASASASSLE CCCCCCCCCCHHHHH | 25.38 | 28889911 | |
58 | Phosphorylation | MGSSASASASSLEMW CCCCCCCCHHHHHHH | 26.62 | 28889911 | |
60 | Phosphorylation | SSASASASSLEMWEK CCCCCCHHHHHHHHH | 32.72 | 28889911 | |
75 | Phosphorylation | DLEERLNSIDHDMNN HHHHHHHHCCCCCCC | 33.70 | 22369663 | |
84 | Ubiquitination | DHDMNNNKFGSGELK CCCCCCCCCCHHHHH | 53.91 | 24961812 | |
84 | Acetylation | DHDMNNNKFGSGELK CCCCCCCCCCHHHHH | 53.91 | 24489116 | |
87 | Phosphorylation | MNNNKFGSGELKSMF CCCCCCCHHHHHHHH | 32.02 | 22369663 | |
91 | Ubiquitination | KFGSGELKSMFNQGK CCCHHHHHHHHHCCC | 35.26 | 23749301 | |
91 | Acetylation | KFGSGELKSMFNQGK CCCHHHHHHHHHCCC | 35.26 | 24489116 | |
92 | Phosphorylation | FGSGELKSMFNQGKV CCHHHHHHHHHCCCC | 41.03 | 21440633 | |
98 | Ubiquitination | KSMFNQGKVEEMDF- HHHHHCCCCEECCC- | 36.39 | 23749301 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SML1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SML1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...