dbPTM

ZIM17_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ZIM17_YEAST
UniProt AC	P42844
Protein Name	Mitochondrial protein import protein ZIM17
Gene Name	ZIM17
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	174
Subcellular Localization	Mitochondrion inner membrane Peripheral membrane protein Matrix side . Soluble matrix protein loosely associated with the inner membrane.
Protein Description	Involved in protein import into mitochondria. Acts as a Hsp70-specific chaperone that prevents self-aggregation of the matrix Hsp70 chaperones SSC1 (mtHSP70) and SSQ1, thereby maintaining their function in mitochondrial protein import and Fe/S protein biosynthesis. May act together with PAM18 as co-chaperone to facilitate recognition and folding of imported proteins by SSC1 in the mitochondrial matrix..
Protein Sequence	MIPRTRTLLQSKIPITRYFARCWAPRVRYNVCRTLPAAALHTNIIAHNEVKKDDKKVHLGSFKVDKPKMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHDHHVTVEQLMKANGEQVSQDVGDLEFEDIPDSLKDVLGKYAKNNSENASQLPHPSQK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
61	Phosphorylation	DKKVHLGSFKVDKPK CCEEEECEEECCCCC	28.40	30377154
172	Phosphorylation	ASQLPHPSQK----- HHHCCCCCCC-----	47.79	27017623

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ZIM17_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ZIM17_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ZIM17_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HSP77_YEAST	SSC1	physical	15642367
HSP77_YEAST	SSC1	physical	17571076
CTF18_YEAST	CTF18	genetic	21511814
MUS81_YEAST	MUS81	genetic	21511814
RAD24_YEAST	RAD24	genetic	21511814
HSP77_YEAST	SSC1	physical	23063975

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ZIM17_YEAST

Related Literatures of Post-Translational Modification