| UniProt ID | 1B18_HUMAN | |
|---|---|---|
| UniProt AC | P30466 | |
| Protein Name | HLA class I histocompatibility antigen, B-18 alpha chain | |
| Gene Name | HLA-B | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 362 | |
| Subcellular Localization |
Membrane Single-pass type I membrane protein. |
|
| Protein Description | Involved in the presentation of foreign antigens to the immune system.. | |
| Protein Sequence | MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPRFISVGYVDGTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGTCVEWLRRHLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGKGGSYSQAASSDSAQGSDVSLTA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 125 | S-palmitoylation | TLQRMYGCDVGPDGR CHHHHHCCCCCCCCC | 1.80 | 29575903 | |
| 145 | Ubiquitination | DQSAYDGKDYIALNE CCCCCCCCCEEEECC | 44.45 | 21906983 | |
| 170 | Ubiquitination | AAQITQRKWEAARVA HHHHHHHHHHHHHHH | 39.30 | 21906983 | |
| 188 | Glutathionylation | RAYLEGTCVEWLRRH HHHHHCHHHHHHHHH | 3.72 | 22555962 | |
| 200 | Ubiquitination | RRHLENGKETLQRAD HHHHHHCHHHHHHCC | 60.14 | 21906983 | |
| 267 | Ubiquitination | AGDRTFQKWAAVVVP CCCCCEEEEEEEEEC | 34.31 | 21906983 | |
| 292 | Ubiquitination | VQHEGLPKPLTLRWE EEECCCCCCEEEEEC | 58.67 | 21906983 | |
| 340 | Ubiquitination | RRKSSGGKGGSYSQA CCCCCCCCCCCHHCC | 64.72 | 21906983 | |
| 356 | Phosphorylation | SSDSAQGSDVSLTA- CCCCCCCCCCCCCC- | 23.82 | 17081983 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of 1B18_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of 1B18_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of 1B18_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
