UniProt ID | FCGRN_HUMAN | |
---|---|---|
UniProt AC | P55899 | |
Protein Name | IgG receptor FcRn large subunit p51 | |
Gene Name | FCGRT | |
Organism | Homo sapiens (Human). | |
Sequence Length | 365 | |
Subcellular Localization |
Cell membrane Single-pass type I membrane protein . |
|
Protein Description | Binds to the Fc region of monomeric immunoglobulins gamma. [PubMed: 7964511] | |
Protein Sequence | MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
125 | N-linked_Glycosylation | GCELGPDNTSVPTAK CCEECCCCCCCCCEE | 37.07 | UniProtKB CARBOHYD | |
213 | Phosphorylation | RLKARPSSPGFSVLT EEEECCCCCCCEEEE | 31.55 | 22210691 | |
225 | Phosphorylation | VLTCSAFSFYPPELQ EEEEECCEECCHHHH | 24.48 | 22210691 | |
227 | Phosphorylation | TCSAFSFYPPELQLR EEECCEECCHHHHHH | 19.38 | 22210691 | |
262 | Phosphorylation | GSFHASSSLTVKSGD CCEEECCCEEECCCC | 26.09 | - | |
334 | Phosphorylation | GLPAPWISLRGDDTG CCCCCEEEEECCCCE | 14.24 | 24972180 | |
346 | O-linked_Glycosylation | DTGVLLPTPGEAQDA CCEEECCCCCCCCCC | 43.85 | OGP | |
346 | Phosphorylation | DTGVLLPTPGEAQDA CCEEECCCCCCCCCC | 43.85 | 26657352 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FCGRN_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FCGRN_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FCGRN_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...