| UniProt ID | DPS1_HUMAN | |
|---|---|---|
| UniProt AC | Q5T2R2 | |
| Protein Name | Decaprenyl-diphosphate synthase subunit 1 | |
| Gene Name | PDSS1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 415 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | Supplies decaprenyl diphosphate, the precursor for the side chain of the isoprenoid quinones ubiquinone-10.. | |
| Protein Sequence | MASRWWRWRRGCSWKPAARSPGPGSPGRAGPLGPSAAAEVRAQVHRRKGLDLSQIPYINLVKHLTSACPNVCRISRFHHTTPDSKTHSGEKYTDPFKLGWRDLKGLYEDIRKELLISTSELKEMSEYYFDGKGKAFRPIIVALMARACNIHHNNSRHVQASQRAIALIAEMIHTASLVHDDVIDDASSRRGKHTVNKIWGEKKAVLAGDLILSAASIALARIGNTTVISILTQVIEDLVRGEFLQLGSKENENERFAHYLEKTFKKTASLIANSCKAVSVLGCPDPVVHEIAYQYGKNVGIAFQLIDDVLDFTSCSDQMGKPTSADLKLGLATGPVLFACQQFPEMNAMIMRRFSLPGDVDRARQYVLQSDGVQQTTYLAQQYCHEAIREISKLRPSPERDALIQLSEIVLTRDK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 20 | Phosphorylation | SWKPAARSPGPGSPG CCCCCCCCCCCCCCC | 29.49 | 29396449 | |
| 25 | Phosphorylation | ARSPGPGSPGRAGPL CCCCCCCCCCCCCCC | 27.58 | 28102081 | |
| 35 | Phosphorylation | RAGPLGPSAAAEVRA CCCCCCHHHHHHHHH | 28.83 | 29396449 | |
| 58 (in isoform 3) | Ubiquitination | - | 2.42 | 21890473 | |
| 65 (in isoform 3) | Ubiquitination | - | 17.63 | 21890473 | |
| 97 (in isoform 2) | Ubiquitination | - | 52.02 | 21890473 | |
| 97 (in isoform 1) | Ubiquitination | - | 52.02 | 21890473 | |
| 97 | Ubiquitination | EKYTDPFKLGWRDLK CCCCCCHHCCHHHHH | 52.02 | 21890473 | |
| 104 | Acetylation | KLGWRDLKGLYEDIR HCCHHHHHHHHHHHH | 51.68 | 20167786 | |
| 104 (in isoform 2) | Ubiquitination | - | 51.68 | 21890473 | |
| 104 (in isoform 1) | Ubiquitination | - | 51.68 | 21890473 | |
| 104 | Ubiquitination | KLGWRDLKGLYEDIR HCCHHHHHHHHHHHH | 51.68 | 22817900 | |
| 117 | Phosphorylation | IRKELLISTSELKEM HHHHHHCCHHHHHHH | 26.33 | 24114839 | |
| 119 | Phosphorylation | KELLISTSELKEMSE HHHHCCHHHHHHHHH | 33.85 | 24114839 | |
| 125 | Phosphorylation | TSELKEMSEYYFDGK HHHHHHHHHHHCCCC | 24.44 | 25072903 | |
| 127 | Phosphorylation | ELKEMSEYYFDGKGK HHHHHHHHHCCCCCC | 11.35 | 25072903 | |
| 128 | Phosphorylation | LKEMSEYYFDGKGKA HHHHHHHHCCCCCCC | 7.37 | 25072903 | |
| 392 | Phosphorylation | HEAIREISKLRPSPE HHHHHHHHCCCCCCC | 22.38 | 22468782 | |
| 397 | Phosphorylation | EISKLRPSPERDALI HHHCCCCCCCHHHHH | 32.72 | 26699800 | |
| 407 | Phosphorylation | RDALIQLSEIVLTRD HHHHHHHHHHHHHCC | 14.65 | 22468782 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DPS1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DPS1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DPS1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of DPS1_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 614651 | Coenzyme Q10 deficiency, primary, 2 (COQ10D2) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
