UniProt ID | KI3S1_HUMAN | |
---|---|---|
UniProt AC | Q14943 | |
Protein Name | Killer cell immunoglobulin-like receptor 3DS1 | |
Gene Name | KIR3DS1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 382 | |
Subcellular Localization |
Cell membrane Single-pass type I membrane protein. |
|
Protein Description | Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.. | |
Protein Sequence | MLLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHVPIFHGRIFQEGFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPMVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHREWISKDPSRLVGQIHDGVSKANFSIGSMMRALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGLYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNLRHLHILIGTSVVKIPFTILLFFLLHRWCSNKKKCCCNGPRACREQK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
92 | N-linked_Glycosylation | VTTAHAGNYTCRGSH CCEEECCCEEECCCC | 29.71 | UniProtKB CARBOHYD | |
179 | N-linked_Glycosylation | HDGVSKANFSIGSMM CCCCHHCCCCHHHHH | 34.63 | UniProtKB CARBOHYD | |
218 | Phosphorylation | DPLDIVVTGLYEKPS CCCEEEEEECCCCCC | 15.58 | 24719451 | |
221 | Phosphorylation | DIVVTGLYEKPSLSA EEEEEECCCCCCCCC | 24.21 | 24719451 | |
225 | Phosphorylation | TGLYEKPSLSAQPGP EECCCCCCCCCCCCC | 46.13 | 28302921 | |
227 | Phosphorylation | LYEKPSLSAQPGPKV CCCCCCCCCCCCCCC | 29.24 | 28302921 | |
245 | Phosphorylation | ESVTLSCSSRSSYDM CCEEEEECCCCCEEC | 25.96 | - | |
246 | Phosphorylation | SVTLSCSSRSSYDMY CEEEEECCCCCEECC | 40.27 | - | |
273 | N-linked_Glycosylation | LPAVRKVNRTFQADF CHHHHCCCCEEECCC | 40.07 | UniProtKB CARBOHYD | |
296 | Phosphorylation | GTYRCFGSFRHSPYE CCEEEEEECCCCCCC | 10.00 | 11733001 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KI3S1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KI3S1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KI3S1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...