| UniProt ID | KI2L2_HUMAN | |
|---|---|---|
| UniProt AC | P43627 | |
| Protein Name | Killer cell immunoglobulin-like receptor 2DL2 | |
| Gene Name | KIR2DL2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 348 | |
| Subcellular Localization |
Cell membrane Single-pass type I membrane protein. |
|
| Protein Description | Receptor on natural killer (NK) cells for HLA-Cw1, 3, 7, and 8 allotypes. Inhibits the activity of NK cells thus preventing cell lysis.. | |
| Protein Sequence | MSLMVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVIGNPSNSWPSPTEPSSKTGNPRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYAELPNAESRSKVVSCP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 30 | Phosphorylation | EGVHRKPSLLAHPGR CCCCCCHHHHCCCCC | 38.76 | 24719451 | |
| 84 | N-linked_Glycosylation | HDGVSKANFSIGPMM CCCCCCCCCCCCHHH | 34.63 | UniProtKB CARBOHYD | |
| 86 | Phosphorylation | GVSKANFSIGPMMQD CCCCCCCCCCHHHHH | 26.83 | - | |
| 98 | Phosphorylation | MQDLAGTYRCYGSVT HHHHCCCEEEEEEEC | 9.58 | - | |
| 101 | Phosphorylation | LAGTYRCYGSVTHSP HCCCEEEEEEECCCC | 11.93 | 18083107 | |
| 109 | Phosphorylation | GSVTHSPYQLSAPSD EEECCCCCCCCCCCC | 25.71 | 18083107 | |
| 126 | Phosphorylation | DIVITGLYEKPSLSA CEEEEECCCCCCCCC | 24.21 | 18083107 | |
| 138 | Phosphorylation | LSAQPGPTVLAGESV CCCCCCCEEECCCCE | 33.78 | - | |
| 150 | Phosphorylation | ESVTLSCSSRSSYDM CCEEEECCCCCCEEC | 25.96 | - | |
| 151 | Phosphorylation | SVTLSCSSRSSYDMY CEEEECCCCCCEECE | 40.27 | - | |
| 178 | N-linked_Glycosylation | FSAGPKVNGTFQADF CCCCCCCCCEEEECC | 50.33 | UniProtKB CARBOHYD | |
| 180 | Phosphorylation | AGPKVNGTFQADFPL CCCCCCCEEEECCCC | 13.84 | - | |
| 211 | N-linked_Glycosylation | DSPYEWSNSSDPLLV CCCCCCCCCCCCEEE | 46.75 | UniProtKB CARBOHYD | |
| 281 | Phosphorylation | AAVMDQESAGNRTAN CEEECHHHCCCCCCC | 35.52 | - | |
| 289 | Phosphorylation | AGNRTANSEDSDEQD CCCCCCCCCCCCCCC | 40.07 | - | |
| 292 | Phosphorylation | RTANSEDSDEQDPQE CCCCCCCCCCCCCCC | 38.71 | - | |
| 302 | Phosphorylation | QDPQEVTYTQLNHCV CCCCCCCHHHHCCEE | 9.54 | 18083107 | |
| 311 | Phosphorylation | QLNHCVFTQRKITRP HHCCEEEECCCCCCC | 13.68 | - | |
| 319 | Phosphorylation | QRKITRPSQRPKTPP CCCCCCCCCCCCCCC | 35.21 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KI2L2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KI2L2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KI2L2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| 1C07_HUMAN | HLA-C | physical | 10850706 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| D10444 | Lirilumab (USAN/INN) | |||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
