UniProt ID | TM171_HUMAN | |
---|---|---|
UniProt AC | Q8WVE6 | |
Protein Name | Transmembrane protein 171 | |
Gene Name | TMEM171 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 324 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MSPAAAAEPDGDQQDRHVSKLIFCFFVFGAVLLCVGVLLSIFGFQACQYKPLPDCPMVLKVAGPACAVVGLGAVILARSRAQLQLRAGLQRGQQMDPDRAFICGESRQFAQCLIFGFLFLTSGMLISVLGIWVPGCGSNWAQEPLNETDTGDSEPRMCGFLSLQIMGPLIVLVGLCFFVVAHVKKRNTLNAGQDASEREEGQIQIMEPVQVTVGDSVIIFPPPPPPYFPESSASAVAESPGTNSLLPNENPPSYYSIFNYGRTPTSEGAASERDCESIYTISGTNSSSEASHTPHLPSELPPRYEEKENAAATFLPLSSEPSPP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
196 | Phosphorylation | LNAGQDASEREEGQI CCCCCCHHHCCCCCE | 45.54 | 28509920 | |
266 | O-linked_Glycosylation | NYGRTPTSEGAASER CCCCCCCCCCCCCHH | 34.92 | 30620550 | |
279 | Phosphorylation | ERDCESIYTISGTNS HHCCCEEEEEECCCC | 13.80 | 27642862 | |
288 | Ubiquitination | ISGTNSSSEASHTPH EECCCCCCCCCCCCC | 36.68 | 22817900 | |
306 | Ubiquitination | ELPPRYEEKENAAAT CCCCCHHHHCCCCCC | 57.65 | 22817900 | |
306 (in isoform 2) | Ubiquitination | - | 57.65 | 21906983 | |
307 | Ubiquitination | LPPRYEEKENAAATF CCCCHHHHCCCCCCC | 44.31 | 22817900 | |
307 (in isoform 1) | Ubiquitination | - | 44.31 | 21906983 | |
313 | Phosphorylation | EKENAAATFLPLSSE HHCCCCCCCCCCCCC | 22.45 | - | |
319 | Phosphorylation | ATFLPLSSEPSPP-- CCCCCCCCCCCCC-- | 62.30 | - | |
322 | Phosphorylation | LPLSSEPSPP----- CCCCCCCCCC----- | 45.83 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TM171_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TM171_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TM171_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...