CKLF4_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CKLF4_HUMAN
• UniProt AC: Q8IZR5
• Protein Name: CKLF-like MARVEL transmembrane domain-containing protein 4
• Gene Name: CMTM4 {ECO:0000312|HGNC:HGNC:19175}
• Organism: Homo sapiens (Human).
• Sequence Length: 234
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Description: Acts as a backup for CMTM6 to regulate plasma membrane expression of PD-L1/CD274, an immune inhibitory ligand critical for immune tolerance to self and antitumor immunity. May protect PD-L1/CD274 from being polyubiquitinated and targeted for degradation..
• Protein Sequence: MRSGEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYLRGALGRLKVAQVILALIAFICIETIMACSPCEGLYFFEFVSCSAFVVTGVLLIMFSLNLHMRIPQINWNLTDLVNTGLSAFLFFIASIVLAALNHRAGAEIAAVIFGFLATAAYAVNTFLAVQKWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFSYSTNVTVRKKSPTNLLSLNHWQLA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
15	Phosphorylation	DGFEGEASSTSMISG CCCCCCCCCCCCCCC	29.82	24719451
16	Phosphorylation	GFEGEASSTSMISGA CCCCCCCCCCCCCCC	31.39	28348404
17	Phosphorylation	FEGEASSTSMISGAS CCCCCCCCCCCCCCC	21.59	29802988
18	Phosphorylation	EGEASSTSMISGASS CCCCCCCCCCCCCCC	18.96	29802988
21	Phosphorylation	ASSTSMISGASSPYQ CCCCCCCCCCCCCCC	21.47	28348404
24	Phosphorylation	TSMISGASSPYQPTT CCCCCCCCCCCCCCC	35.06	27251275
25	Phosphorylation	SMISGASSPYQPTTE CCCCCCCCCCCCCCC	27.39	27251275
27	Phosphorylation	ISGASSPYQPTTEPV CCCCCCCCCCCCCCC	29.13	25884760
163 (in isoform 3)	Phosphorylation	-	6.61	22210691
165 (in isoform 3)	Phosphorylation	-	5.37	22210691
183	Phosphorylation	RVSVRQQSTNDYIRA EEEEEHHHHHHHHHH	22.34	20363803
184	Phosphorylation	VSVRQQSTNDYIRAR EEEEHHHHHHHHHHH	27.98	26356563
187	Phosphorylation	RQQSTNDYIRARTES EHHHHHHHHHHHHHC	8.38	27273156
192	Phosphorylation	NDYIRARTESRDVDS HHHHHHHHHCCCCCC	37.01	26699800
192 (in isoform 2)	Phosphorylation	-	37.01	22210691
194	Phosphorylation	YIRARTESRDVDSRP HHHHHHHCCCCCCCH	32.92	12782130
194 (in isoform 2)	Phosphorylation	-	32.92	22210691
199	Phosphorylation	TESRDVDSRPEIQRL HHCCCCCCCHHHEEC	49.97	26657352
208	Phosphorylation	PEIQRLDTFSYSTNV HHHEECCEEEEECCE	21.05	20363803
210	Phosphorylation	IQRLDTFSYSTNVTV HEECCEEEEECCEEE	21.92	24719451
221	Phosphorylation	NVTVRKKSPTNLLSL CEEEECCCCCCCEEC	39.74	23898821

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CKLF4_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CKLF4_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CKLF4_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RM02_HUMAN	MRPL2	physical	21988832

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.