UniProt ID | LET60_CAEEL | |
---|---|---|
UniProt AC | P22981 | |
Protein Name | Ras protein let-60 | |
Gene Name | let-60 | |
Organism | Caenorhabditis elegans. | |
Sequence Length | 184 | |
Subcellular Localization |
Cell membrane Lipid-anchor. |
|
Protein Description | The level of let-60 controls the switch between vulval and hypodermal cell fates during C.elegans vulval induction. [PubMed: 2257629] | |
Protein Sequence | MTEYKLVVVGDGGVGKSALTIQLIQNHFVEEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAVNEAKSFENVANYREQIRRVKDSDDVPMVLVGNKCDLSSRSVDFRTVSETAKGYGIPNVDTSAKTRMGVDEAFYTLVREIRKHRERHDNNKPQKKKKCQIM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LET60_CAEEL !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LET60_CAEEL !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LET60_CAEEL !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...