dbPTM

GSK3_CAEEL - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	GSK3_CAEEL
UniProt AC	Q9U2Q9
Protein Name	Glycogen synthase kinase-3 {ECO:0000303\|PubMed:16251270}
Gene Name	gsk-3 {ECO:0000312\|WormBase:Y18D10A.5}
Organism	Caenorhabditis elegans.
Sequence Length	362
Subcellular Localization
Protein Description	Phosphorylates oma-1, a regulator of the oocyte-to-embryo transition, enabling its degradation. [PubMed: 16343905]
Protein Sequence	MNKQLLSCSLKSGKQVTMVVASVATDGVDQQVEISYYDQKVIGNGSFGVVFLAKLSTTNEMVAIKKVLQDKRFKNRELQIMRKLNHPNIVKLKYFFYSSGEKKDELYLNLILEYVPETVYRVARHYSKQRQQIPMIYVKLYMYQLLRSLAYIHSIGICHRDIKPQNLLIDPESGVLKLCDFGSAKYLVRNEPNVSYICSRYYRAPELIFGATNYTNSIDVWSAGTVMAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIQSMNPNYKEFKFPQIKAHPWNKVFRVHTPAEAIDLISKIIEYTPTSRPTPQAACQHAFFDELRNPDARLPSGRPLPTLEMDGPMGTGEVSTTSGDVAGPSA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
9	Phosphorylation	NKQLLSCSLKSGKQV CCCHHHEECCCCCCE	35.14	30078680
195	Phosphorylation	VRNEPNVSYICSRYY ECCCCCHHHHCCCCC	18.54	28854356
196	Phosphorylation	RNEPNVSYICSRYYR CCCCCHHHHCCCCCC	11.15	28854356
199	Phosphorylation	PNVSYICSRYYRAPE CCHHHHCCCCCCCCH	17.48	19530675
255	Phosphorylation	EIIKVLGTPTREQIQ HHHHHHCCCCHHHHH	19.82	19264959
289	Phosphorylation	NKVFRVHTPAEAIDL CCEEEECCHHHHHHH	22.72	19264959
304	Phosphorylation	ISKIIEYTPTSRPTP HHHHHHHCCCCCCCC	13.80	19264959
310	Phosphorylation	YTPTSRPTPQAACQH HCCCCCCCCCHHHHH	27.24	19264959

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of GSK3_CAEEL !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of GSK3_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of GSK3_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
PRY1_CAEEL	pry-1	physical	12023307
AXLP1_CAEEL	axl-1	physical	17601533

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of GSK3_CAEEL

Related Literatures of Post-Translational Modification