UniProt ID | GSK3_CAEEL | |
---|---|---|
UniProt AC | Q9U2Q9 | |
Protein Name | Glycogen synthase kinase-3 {ECO:0000303|PubMed:16251270} | |
Gene Name | gsk-3 {ECO:0000312|WormBase:Y18D10A.5} | |
Organism | Caenorhabditis elegans. | |
Sequence Length | 362 | |
Subcellular Localization | ||
Protein Description | Phosphorylates oma-1, a regulator of the oocyte-to-embryo transition, enabling its degradation. [PubMed: 16343905] | |
Protein Sequence | MNKQLLSCSLKSGKQVTMVVASVATDGVDQQVEISYYDQKVIGNGSFGVVFLAKLSTTNEMVAIKKVLQDKRFKNRELQIMRKLNHPNIVKLKYFFYSSGEKKDELYLNLILEYVPETVYRVARHYSKQRQQIPMIYVKLYMYQLLRSLAYIHSIGICHRDIKPQNLLIDPESGVLKLCDFGSAKYLVRNEPNVSYICSRYYRAPELIFGATNYTNSIDVWSAGTVMAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIQSMNPNYKEFKFPQIKAHPWNKVFRVHTPAEAIDLISKIIEYTPTSRPTPQAACQHAFFDELRNPDARLPSGRPLPTLEMDGPMGTGEVSTTSGDVAGPSA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Phosphorylation | NKQLLSCSLKSGKQV CCCHHHEECCCCCCE | 35.14 | 30078680 | |
195 | Phosphorylation | VRNEPNVSYICSRYY ECCCCCHHHHCCCCC | 18.54 | 28854356 | |
196 | Phosphorylation | RNEPNVSYICSRYYR CCCCCHHHHCCCCCC | 11.15 | 28854356 | |
199 | Phosphorylation | PNVSYICSRYYRAPE CCHHHHCCCCCCCCH | 17.48 | 19530675 | |
255 | Phosphorylation | EIIKVLGTPTREQIQ HHHHHHCCCCHHHHH | 19.82 | 19264959 | |
289 | Phosphorylation | NKVFRVHTPAEAIDL CCEEEECCHHHHHHH | 22.72 | 19264959 | |
304 | Phosphorylation | ISKIIEYTPTSRPTP HHHHHHHCCCCCCCC | 13.80 | 19264959 | |
310 | Phosphorylation | YTPTSRPTPQAACQH HCCCCCCCCCHHHHH | 27.24 | 19264959 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GSK3_CAEEL !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GSK3_CAEEL !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GSK3_CAEEL !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PRY1_CAEEL | pry-1 | physical | 12023307 | |
AXLP1_CAEEL | axl-1 | physical | 17601533 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...