UNC6_CAEEL - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: UNC6_CAEEL
• UniProt AC: P34710
• Protein Name: Netrin unc-6
• Gene Name: unc-6
• Organism: Caenorhabditis elegans.
• Sequence Length: 612
• Subcellular Localization: Secreted, extracellular space, extracellular matrix, basement membrane. Epidermal basal lamina.
• Protein Description: Component of an extracellular matrix cue that guides dorsoventral migrations on the epidermis. [PubMed: 8861903 Required for the guidance of pioneer axons and migrating cells along the body wall]
• Protein Sequence: MITSVLRYVLALYFCMGIAHGAYFSQFSMRAPDHDPCHDHTGRPVRCVPEFINAAFGKPVIASDTCGTNRPDKYCTVKEGPDGIIREQCDTCDARNHFQSHPASLLTDLNSIGNMTCWVSTPSLSPQNVSLTLSLGKKFELTYVSMHFCSRLPDSMALYKSADFGKTWTPFQFYSSECRRIFGRDPDVSITKSNEQEAVCTASHIMGPGGNRVAFPFLENRPSAQNFENSPVLQDWVTATDIKVVFSRLSPDQAELYGLSNDVNSYGNETDDEVKQRYFYSMGELAVGGRCKCNGHASRCIFDKMGRYTCDCKHNTAGTECEMCKPFHYDRPWGRATANSANSCVACNCNQHAKRCRFDAELFRLSGNRSGGVCLNCRHNTAGRNCHLCKPGFVRDTSLPMTHRKACKSCGCHPVGSLGKSCNQSSGQCVCKPGVTGTTCNRCAKGYQQSRSTVTPCIKIPTKADFIGSSHSEEQDQCSKCRIVPKRLNQKKFCKRDHAVQMVVVSREMVDGWAKYKIVVESVFKRGTENMQRGETSLWISPQGVICKCPKLRVGRRYLLLGKNDSDHERDGLMVNPQTVLVEWEDDIMDKVLRFSKKDKLGQCPEITSHRY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
114	N-linked_Glycosylation	TDLNSIGNMTCWVST HCHHHCCCCEEEEEC	22.41	-
128	N-linked_Glycosylation	TPSLSPQNVSLTLSL CCCCCCCEEEEEEEC	28.82	-
268	N-linked_Glycosylation	NDVNSYGNETDDEVK CCHHHCCCCCCHHHH	40.54	-
368	N-linked_Glycosylation	ELFRLSGNRSGGVCL HHHHCCCCCCCCEEE	31.41	-
423	N-linked_Glycosylation	GSLGKSCNQSSGQCV CCCCCCCCCCCCCEE	52.43	-
564	N-linked_Glycosylation	RYLLLGKNDSDHERD EEEEEECCCCHHCCC	52.82	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of UNC6_CAEEL !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of UNC6_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of UNC6_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.