UniProt ID | UNC6_CAEEL | |
---|---|---|
UniProt AC | P34710 | |
Protein Name | Netrin unc-6 | |
Gene Name | unc-6 | |
Organism | Caenorhabditis elegans. | |
Sequence Length | 612 | |
Subcellular Localization | Secreted, extracellular space, extracellular matrix, basement membrane. Epidermal basal lamina. | |
Protein Description | Component of an extracellular matrix cue that guides dorsoventral migrations on the epidermis. [PubMed: 8861903 Required for the guidance of pioneer axons and migrating cells along the body wall] | |
Protein Sequence | MITSVLRYVLALYFCMGIAHGAYFSQFSMRAPDHDPCHDHTGRPVRCVPEFINAAFGKPVIASDTCGTNRPDKYCTVKEGPDGIIREQCDTCDARNHFQSHPASLLTDLNSIGNMTCWVSTPSLSPQNVSLTLSLGKKFELTYVSMHFCSRLPDSMALYKSADFGKTWTPFQFYSSECRRIFGRDPDVSITKSNEQEAVCTASHIMGPGGNRVAFPFLENRPSAQNFENSPVLQDWVTATDIKVVFSRLSPDQAELYGLSNDVNSYGNETDDEVKQRYFYSMGELAVGGRCKCNGHASRCIFDKMGRYTCDCKHNTAGTECEMCKPFHYDRPWGRATANSANSCVACNCNQHAKRCRFDAELFRLSGNRSGGVCLNCRHNTAGRNCHLCKPGFVRDTSLPMTHRKACKSCGCHPVGSLGKSCNQSSGQCVCKPGVTGTTCNRCAKGYQQSRSTVTPCIKIPTKADFIGSSHSEEQDQCSKCRIVPKRLNQKKFCKRDHAVQMVVVSREMVDGWAKYKIVVESVFKRGTENMQRGETSLWISPQGVICKCPKLRVGRRYLLLGKNDSDHERDGLMVNPQTVLVEWEDDIMDKVLRFSKKDKLGQCPEITSHRY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
114 | N-linked_Glycosylation | TDLNSIGNMTCWVST HCHHHCCCCEEEEEC | 22.41 | - | |
128 | N-linked_Glycosylation | TPSLSPQNVSLTLSL CCCCCCCEEEEEEEC | 28.82 | - | |
268 | N-linked_Glycosylation | NDVNSYGNETDDEVK CCHHHCCCCCCHHHH | 40.54 | - | |
368 | N-linked_Glycosylation | ELFRLSGNRSGGVCL HHHHCCCCCCCCEEE | 31.41 | - | |
423 | N-linked_Glycosylation | GSLGKSCNQSSGQCV CCCCCCCCCCCCCEE | 52.43 | - | |
564 | N-linked_Glycosylation | RYLLLGKNDSDHERD EEEEEECCCCHHCCC | 52.82 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UNC6_CAEEL !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UNC6_CAEEL !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UNC6_CAEEL !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...