UniProt ID | CGH1_CAEEL | |
---|---|---|
UniProt AC | Q95YF3 | |
Protein Name | ATP-dependent RNA helicase cgh-1 | |
Gene Name | cgh-1 | |
Organism | Caenorhabditis elegans. | |
Sequence Length | 430 | |
Subcellular Localization | Cytoplasm . Cytoplasmic when associated with pgl-1. Associates with P granules and this localization is dependent on ifet-1. | |
Protein Description | Probable RNA helicase required for oocyte and sperm function. Also required to prevent the physiological germline apoptosis mechanism killing essentially all developing oocytes.. | |
Protein Sequence | MSGAEQQQIVPANNGDENWKAGLNLPAKDRRFKTADVTDTKGVEFEDFCLGRDLLMGIFEKGWEKPSPIQEASIGVALTGQDILARAKNGTGKTGAYCIPVIEKIQPALKAIQAMVIVPTRELALQTSQICVELSKHIQLKVMVTTGGTDLRDDIMRLNGTVHLVIATPGRILDLMEKGVAKMEHCKTLVLDEADKLLSQDFQGILDRLINFLPKERQVMLYSATFPNTVTSFMQKHMHKPYEINLMEELTLLGVTQYYAFVQEKQKVHCLNTLFRKLQINQSIIFCNSTQRVELLAKKITEIGYSCYYIHSKMAQNHRNRVFHDFRQGNCRNLVCSDLLTRGIDIQAVNVVINFDFPRNAETYLHRIGRSGRFGHLGVAINLITYEDRHTLRRIEQELRTRIEPIPKTVDPKLYVADQQLVDAADETTA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSGAEQQQI ------CCCHHCCCC | 46.87 | 28854356 | |
428 | Phosphorylation | LVDAADETTA----- HHHHHHHCCC----- | 28.68 | 18806794 | |
429 | Phosphorylation | VDAADETTA------ HHHHHHCCC------ | 28.46 | 30078680 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CGH1_CAEEL !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CGH1_CAEEL !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CGH1_CAEEL !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RL8_CAEEL | rpl-2 | physical | 14704431 | |
SRD30_CAEEL | srd-30 | physical | 14704431 | |
KARG1_CAEEL | F46H5.3 | physical | 14704431 | |
DCAM_CAEEL | smd-1 | physical | 18692475 | |
MED7_CAEEL | let-49 | physical | 18692475 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...