| UniProt ID | CGH1_CAEEL | |
|---|---|---|
| UniProt AC | Q95YF3 | |
| Protein Name | ATP-dependent RNA helicase cgh-1 | |
| Gene Name | cgh-1 | |
| Organism | Caenorhabditis elegans. | |
| Sequence Length | 430 | |
| Subcellular Localization | Cytoplasm . Cytoplasmic when associated with pgl-1. Associates with P granules and this localization is dependent on ifet-1. | |
| Protein Description | Probable RNA helicase required for oocyte and sperm function. Also required to prevent the physiological germline apoptosis mechanism killing essentially all developing oocytes.. | |
| Protein Sequence | MSGAEQQQIVPANNGDENWKAGLNLPAKDRRFKTADVTDTKGVEFEDFCLGRDLLMGIFEKGWEKPSPIQEASIGVALTGQDILARAKNGTGKTGAYCIPVIEKIQPALKAIQAMVIVPTRELALQTSQICVELSKHIQLKVMVTTGGTDLRDDIMRLNGTVHLVIATPGRILDLMEKGVAKMEHCKTLVLDEADKLLSQDFQGILDRLINFLPKERQVMLYSATFPNTVTSFMQKHMHKPYEINLMEELTLLGVTQYYAFVQEKQKVHCLNTLFRKLQINQSIIFCNSTQRVELLAKKITEIGYSCYYIHSKMAQNHRNRVFHDFRQGNCRNLVCSDLLTRGIDIQAVNVVINFDFPRNAETYLHRIGRSGRFGHLGVAINLITYEDRHTLRRIEQELRTRIEPIPKTVDPKLYVADQQLVDAADETTA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSGAEQQQI ------CCCHHCCCC | 46.87 | 28854356 | |
| 428 | Phosphorylation | LVDAADETTA----- HHHHHHHCCC----- | 28.68 | 18806794 | |
| 429 | Phosphorylation | VDAADETTA------ HHHHHHCCC------ | 28.46 | 30078680 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CGH1_CAEEL !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CGH1_CAEEL !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CGH1_CAEEL !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RL8_CAEEL | rpl-2 | physical | 14704431 | |
| SRD30_CAEEL | srd-30 | physical | 14704431 | |
| KARG1_CAEEL | F46H5.3 | physical | 14704431 | |
| DCAM_CAEEL | smd-1 | physical | 18692475 | |
| MED7_CAEEL | let-49 | physical | 18692475 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
