KARG1_CAEEL - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: KARG1_CAEEL
• UniProt AC: Q10454
• Protein Name: Probable arginine kinase F46H5.3
• Gene Name: F46H5.3
• Organism: Caenorhabditis elegans.
• Sequence Length: 396
• Protein Sequence: MLHRCSRVLSQFLGRGNSKMLREAYSTSLHCVQAQEGMSVSPDVIAKIEEGYAKLQAAPECHSLLKKYLTKEVVDQLKDKKTKLGANLLDVIQSGVANLDSGVGVYAPDAEAYTLFKPLFDPLIQDYHNGFAPDAKQPNTDLGEGKTSALVDLDPEGKFINSTRIRCGRSLQGYPFNPCLSEANYLEMESKVKAIFDNITDPELAGKYFPLDGMTKEIQDQLIKDHFLFKEGDRFLQAANACRYWPKGRGIFHNNQKTFLIWCNEEDHLRIISMQEGGNVGQVLERLIKGVKTIEKQAPFSRDDRLGWLTFCPSNLGTTVRASVHIRLPKISAKPDFKSICDGLKLQIRGIHGEHSESEGGVYDISNKARLGLTEFEAVKQMYDGIAHLIALEKAA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
39	Phosphorylation	VQAQEGMSVSPDVIA HHHCCCCCCCHHHHH	30.24	19530675
41	Phosphorylation	AQEGMSVSPDVIAKI HCCCCCCCHHHHHHH	14.21	19530675
52	Phosphorylation	IAKIEEGYAKLQAAP HHHHHHHHHHHHHCH	12.11	27067626
127	Phosphorylation	FDPLIQDYHNGFAPD HHHHHHHHHCCCCCC	4.84	28854356
356	Phosphorylation	RGIHGEHSESEGGVY EEECCCCCCCCCCEE	38.22	28854356
358	Phosphorylation	IHGEHSESEGGVYDI ECCCCCCCCCCEEEC	44.55	19060867
363	Phosphorylation	SESEGGVYDISNKAR CCCCCCEEECCCCEE	15.72	27067626

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of KARG1_CAEEL !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of KARG1_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of KARG1_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.