dbPTM

SUMO_CAEEL - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SUMO_CAEEL
UniProt AC	P55853
Protein Name	Small ubiquitin-related modifier
Gene Name	smo-1
Organism	Caenorhabditis elegans.
Sequence Length	91
Subcellular Localization	Cytoplasm . Nucleus . Cytoplasm, cytoskeleton, spindle . Chromosome . Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . At the first embryonic mitotic division, enriched in the nucleus and released to the cytoplasm when the nuclear
Protein Description	Ubiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. [PubMed: 11806825 Plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction]
Protein Sequence	MADDAAQAGDNAEYIKIKVVGQDSNEVHFRVKYGTSMAKLKKSYADRTGVAVNSLRFLFDGRRINDDDTPKTLEMEDDDVIEVYQEQLGGF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
14	Phosphorylation	QAGDNAEYIKIKVVG HCCCCCEEEEEEEEC	12.71	19530675
24	Phosphorylation	IKVVGQDSNEVHFRV EEEECCCCCEEEEEE	27.31	22923814

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SUMO_CAEEL !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SUMO_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SUMO_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SOP2_CAEEL	sop-2	physical	15107848
SUMO_CAEEL	smo-1	physical	18692475
MEP1_CAEEL	mep-1	physical	18692475
GEI17_CAEEL	gei-17	physical	18692475
TPM1_CAEEL	lev-11	physical	18692475
TPM3_CAEEL	lev-11	physical	18692475

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SUMO_CAEEL

Related Literatures of Post-Translational Modification