14331_CAEEL - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: 14331_CAEEL
• UniProt AC: P41932
• Protein Name: 14-3-3-like protein 1
• Gene Name: par-5
• Organism: Caenorhabditis elegans.
• Sequence Length: 248
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Sequence: MSDTVEELVQRAKLAEQAERYDDMAAAMKKVTEQGQELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQQLAKEYRVKVEQELNDICQDVLKLLDEFLIVKAGAAESKVFYLKMKGDYYRYLAEVASEDRAAVVEKSQKAYQEALDIAKDKMQPTHPIRLGLALNFSVFYYEILNTPEHACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDVGAEDQEQEGNQEAGN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSDTVEELV ------CCHHHHHHH	41.82	28854356
4	Phosphorylation	----MSDTVEELVQR ----CCHHHHHHHHH	23.62	19530675
47	Phosphorylation	NEERNLLSVAYKNVV HHHHHHHHHHHHHHH	14.10	28854356
65	Phosphorylation	RSSWRVISSIEQKTE HHHHHHHHHHHHHCC	23.54	19530675
66	Phosphorylation	SSWRVISSIEQKTEG HHHHHHHHHHHHCCC	21.01	19530675
215	Phosphorylation	NEDSYKDSTLIMQLL CCCCCCCHHHHHHHH	22.44	30078680
216	Phosphorylation	EDSYKDSTLIMQLLR CCCCCCHHHHHHHHH	30.36	30078680

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of 14331_CAEEL !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of 14331_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of 14331_CAEEL !!

Protein-Protein Interaction

Oops, there are no PPI records of 14331_CAEEL !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.