| UniProt ID | MPK1_CAEEL | |
|---|---|---|
| UniProt AC | P39745 | |
| Protein Name | Mitogen-activated protein kinase mpk-1 | |
| Gene Name | mpk-1 | |
| Organism | Caenorhabditis elegans. | |
| Sequence Length | 444 | |
| Subcellular Localization | ||
| Protein Description | Function in let-60 Ras signaling pathway; acts downstream of lin-45 raf kinase, but before the lin-1 gene product in controlling vulval cell differentiation. [PubMed: 8299935] | |
| Protein Sequence | MPTWIPNNLCAQPTTRNAKPPSNGHPQATQQQSAPGSLAYRNSSNIPNGATNHVRQQKWQYTRSGHRKMADGEAVISTVNNVEEVHGQLFEVAPRYVNLSYIGEGAYGMVASALDTITRDRVAIKKISPFEHQTFCQRTLREIKILNRFKHENIINIQEIIRSETVDSLKDIYIVQCLMETDLYKLLKTQKLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVTDPQTDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDVWSVGCILAEMLSNRPLFPGKHYLDQLNLILAVVGSPSNADLQCIINDKARSYLISLPHKPKQPWARLYPGADPRALDLLDKMLTFNPHNRIDIEQALAHPYLEQYYDPGDEPVCEEPFTLEMEFDDLPKEKLKELIWEEAEAHHRRMEAEAAARNNGGQNPV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 256 | Phosphorylation | TDHTGFLTEYVATRW CCCCCHHHHHHHHCC | 28854356 | ||
| 258 | Phosphorylation | HTGFLTEYVATRWYR CCCHHHHHHHHCCCC | 8299936 | ||
| 261 | Phosphorylation | FLTEYVATRWYRAPE HHHHHHHHCCCCCCE | 19530675 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MPK1_CAEEL !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MPK1_CAEEL !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MPK1_CAEEL !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PPME1_CAEEL | B0464.9 | physical | 14704431 | |
| CSN5_CAEEL | csn-5 | physical | 14704431 | |
| NHR64_CAEEL | nhr-64 | physical | 14704431 | |
| MLRH_CAEEL | mlc-4 | physical | 14704431 | |
| UNC98_CAEEL | unc-98 | physical | 14704431 | |
| YLU3_CAEEL | F10E9.3 | physical | 14704431 | |
| FIGL1_CAEEL | figl-1 | physical | 14704431 | |
| IFA1_CAEEL | ifa-1 | physical | 14704431 | |
| DGC14_CAEEL | ess-2 | physical | 14704431 | |
| HUTH1_CAEEL | haly-1 | physical | 14704431 | |
| GCDH_CAEEL | F54D5.7 | physical | 14704431 | |
| KCC2D_CAEEL | unc-43 | physical | 14704431 | |
| IFC2_CAEEL | ifc-2 | physical | 14704431 | |
| KS6A1_CAEEL | rskn-1 | physical | 14704431 | |
| NHR69_CAEEL | nhr-69 | physical | 14704431 | |
| YGH1_CAEEL | skp-1 | physical | 14704431 | |
| IFA2_CAEEL | mua-6 | physical | 14704431 | |
| DHYS_CAEEL | dhps-1 | physical | 14704431 | |
| MEK2_CAEEL | mek-2 | physical | 14704431 | |
| VINC_CAEEL | deb-1 | physical | 14704431 | |
| GLS1_CAEEL | gls-1 | physical | 18692475 | |
| LMN1_CAEEL | lmn-1 | physical | 18692475 | |
| DNJ10_CAEEL | dnj-10 | physical | 18692475 | |
| SAS5_CAEEL | sas-5 | physical | 18692475 | |
| GLD1_CAEEL | gld-1 | physical | 18692475 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
