UniProt ID | MEK2_CAEEL | |
---|---|---|
UniProt AC | Q10664 | |
Protein Name | Dual specificity mitogen-activated protein kinase kinase mek-2 | |
Gene Name | mek-2 | |
Organism | Caenorhabditis elegans. | |
Sequence Length | 387 | |
Subcellular Localization | ||
Protein Description | Functions in the let-60 Ras signaling pathway; acts downstream of lin-45 raf kinase, but before the sur-1/mpk-1 gene product in controlling vulval cell differentiation. [PubMed: 7729690 Required for progression of developing oocytes through the pachytene stage] | |
Protein Sequence | MSSGKRRNPLGLSLPPTVNEQSESGEATAEEATATVPLEEQLKKLGLTEPQTQRLSEFLQVKEGIKELSEDMLQTEGELGHGNGGVVNKCVHRKTGVIMARKLVHLEIKPSVRQQIVKELAVLHKCNSPFIVGFYGAFVDNNDISICMEYMDGLSLDIVLKKVGRLPEKFVGRISVAVVRGLTYLKDEIKILHRDVKPSNMLVNSNGEIKLCDFGVSGMLIDSMANSFVGTRSYMAPERLTGSHYTISSDIWSFGLSLVELLIGRYPVPAPSQAEYATMFNVAENEIELADSLEEPNYHPPSNPASMAIFEMLDYIVNGPPPTLPKRFFTDEVIGFVSKCLRKLPSERATLKSLTADVFFTQYADHDDQGEFAVFVKGTINLPKLNP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
75 | Phosphorylation | LSEDMLQTEGELGHG HCHHHHHCCCCCCCC | 41.83 | 19530675 | |
223 | Phosphorylation | VSGMLIDSMANSFVG CCCHHHHHHHHCCCC | 16.89 | - | |
227 | Phosphorylation | LIDSMANSFVGTRSY HHHHHHHCCCCCCCC | 16.27 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MEK2_CAEEL !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MEK2_CAEEL !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MEK2_CAEEL !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KRAF1_CAEEL | lin-45 | physical | 18692475 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...