| UniProt ID | KRAF1_CAEEL | |
|---|---|---|
| UniProt AC | Q07292 | |
| Protein Name | Raf homolog serine/threonine-protein kinase | |
| Gene Name | lin-45 | |
| Organism | Caenorhabditis elegans. | |
| Sequence Length | 813 | |
| Subcellular Localization | ||
| Protein Description | Protein kinase that participates in the induction of vulva and has roles in fertility and viability. Acts downstream of the Ras protein let-60. [PubMed: 8483497] | |
| Protein Sequence | MSRINFKKSSASTTPTSPHCPSPRLISLPRCASSSIDRKDQASPMASPSTPLYPKHSDSLHSLSGHHSAGGAGTSDKEPPKFKYKMIMVHLPFDQHSRVEVRPGETARDAISKLLKKRNITPQLCHVNASSDPKQESIELSLTMEEIASRLPGNELWVHSEYLNTVSSIKHAIVRRTFIPPKSCDVCNNPIWMMGFRCEFCQFKFHQRCSSFAPLYCDLLQSVPKNEDLVKELFGIASQVEGPDRSVAEIVLANLAPTSGQSPAATPDSSHPDLTSIKRTGGVKRHPMAVSPQNETSQLSPSGPYPRDRSSSAPNINAINDEATVQHNQRILDALEAQRLEEESRDKTGSLLSTQARHRPHFQSGHILSGARMNRLHPLVDCTPLGSNSPSSTCSSPPGGLIGQPTLGQSPNVSGSTTSSLVAAHLHTLPLTPPQSAPPQKISPGFFRNRSRSPGERLDAQRPRPPQKPHHEDWEILPNEFIIQYKVGSGSFGTVYRGEFFGTVAIKKLNVVDPTPSQMAAFKNEVAVLKKTRHLNVLLFMGWVREPEIAIITQWCEGSSLYRHIHVQEPRVEFEMGAIIDILKQVSLGMNYLHSKNIIHRDLKTNNIFLMDDMSTVKIGDFGLATVKTKWTVNGGQQQQQPTGSILWMAPEVIRMQDDNPYTPQSDVYSFGICMYEILSSHLPYSNINNRDQILFMVGRGYLRPDRSKIRHDTPKSMLKLYDNCIMFDRNERPVFGEVLERLRDIILPKLTRSQSAPNVLHLDSQYSVMDAVMRSQMLSWSYIPPATAKTPQSAAAAAAANKKAYYNVYGLI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 291 | Phosphorylation | KRHPMAVSPQNETSQ CCCCCCCCCCCCCCC | 15.95 | 21082442 | |
| 300 | Phosphorylation | QNETSQLSPSGPYPR CCCCCCCCCCCCCCC | 14.91 | 21082442 | |
| 310 | Phosphorylation | GPYPRDRSSSAPNIN CCCCCCCCCCCCCCC | 32.69 | 30078680 | |
| 311 | Phosphorylation | PYPRDRSSSAPNINA CCCCCCCCCCCCCCC | 31.26 | 30078680 | |
| 312 | Phosphorylation | YPRDRSSSAPNINAI CCCCCCCCCCCCCCC | 49.33 | 14724126 | |
| 443 | Phosphorylation | SAPPQKISPGFFRNR CCCCCCCCCCCCCCC | 26.46 | 30078680 | |
| 453 | Phosphorylation | FFRNRSRSPGERLDA CCCCCCCCCCCCCCC | 38.20 | 14724126 | |
| 626 | Phosphorylation | IGDFGLATVKTKWTV ECCCEEEEEEEEEEE | 27.81 | 16085714 | |
| 629 | Phosphorylation | FGLATVKTKWTVNGG CEEEEEEEEEEECCC | 27.72 | 16085714 | |
| 754 | Phosphorylation | ILPKLTRSQSAPNVL HHHHCCCCCCCCCEE | 24.21 | 30078680 | |
| 756 | Phosphorylation | PKLTRSQSAPNVLHL HHCCCCCCCCCEEEC | 47.11 | 30078680 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KRAF1_CAEEL !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KRAF1_CAEEL !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KRAF1_CAEEL !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PAL1_CAEEL | pal-1 | physical | 14704431 | |
| TOM20_CAEEL | tomm-20 | physical | 14704431 | |
| SMS1_CAEEL | sms-1 | physical | 14704431 | |
| SAHH_CAEEL | ahcy-1 | physical | 14704431 | |
| EGG6_CAEEL | egg-6 | physical | 14704431 | |
| RL13A_CAEEL | rpl-16 | physical | 14704431 | |
| EGL27_CAEEL | egl-27 | genetic | 16845399 | |
| LIN3_CAEEL | lin-3 | genetic | 16845399 | |
| NHR49_CAEEL | nhr-49 | genetic | 16845399 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
