dbPTM

SMS1_CAEEL - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SMS1_CAEEL
UniProt AC	Q9U3D4
Protein Name	Phosphatidylcholine:ceramide cholinephosphotransferase 1
Gene Name	sms-1
Organism	Caenorhabditis elegans.
Sequence Length	469
Subcellular Localization	Golgi apparatus membrane Multi-pass membrane protein.
Protein Description	Sphingomyelin synthases synthesize the sphingolipid, sphingomyelin, through transfer of the phosphatidyl head group, phosphatidylcholine, on to the primary hydroxyl of ceramide. The reaction is bidirectional depending on the respective levels of the sphingolipid and ceramide..
Protein Sequence	MSVTVEVADEETHDVPLVEQVRTTPDQNVDVKVQENNVVTTKIGPKLETIPAAKMQDDNGDEEKAENSEGAAAEKVEKQHDDDGVVVHEETDGVASSRSSHHDKQKPGETKKSGDGKMDDDDIITTARSSSRRICGSAASSSDSETADDAPLLPDEGPSHAVRLEMPGDKPASPHDRFPKTPLKTLVAFLMLVVAAAGNTITLSWIHERYPLTPPLPDIVFELIPKIPWGLRLCENLMIGSFVSLLVLILFHRHRWIVLRRLCFIGSILYGMRCITMMVTPVPKADEDFECSPRFGENATFSLIVMRGVWSMFGLGLNLFDNQKVVLCGDYIYSGHTLVLVVSALFIGEYSPRRFYILHWLSWLVCSVGVIFLVLSHGHYTIDVILSYFACTRVFWAYHTQAAHPSIRLSVQNHQAKEFWFPLLRWFEGDIRRPVPRRFDCPISYSQVCNAFRRVRPRGRNGAARPAFE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of SMS1_CAEEL !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SMS1_CAEEL !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SMS1_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SMS1_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of SMS1_CAEEL !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SMS1_CAEEL

Related Literatures of Post-Translational Modification