TOM20_CAEEL - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TOM20_CAEEL
• UniProt AC: Q19766
• Protein Name: Mitochondrial import receptor subunit TOM20 homolog
• Gene Name: tomm-20 {ECO:0000312|WormBase:F23H12.2}
• Organism: Caenorhabditis elegans.
• Sequence Length: 188
• Subcellular Localization: Mitochondrion outer membrane ; Single-pass membrane protein .
• Protein Description: Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins (By similarity). Together with tomm-22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the translocation pore. [PubMed: 21264209]
• Protein Sequence: MSDTILGFNKSNVVLAAGIAGAAFLGYCIYFDHKRINAPDYKDKIRQKRRAQAGAGGMAPRRPAAAGNDAAPDVTDPSQMQRFFLQEVQLGEELMAAGNVDEGAVHIANAVMLCGESQQLLSIFQQTLSEDQFRAVVQQLPSTRERLAEMFGAKADEAENEPPMVQYLGDGPPPAQIQELIDDTDDLE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of TOM20_CAEEL !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TOM20_CAEEL !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TOM20_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TOM20_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PEX19_CAEEL	prx-19	physical	14704431

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.