RL13A_CAEEL - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL13A_CAEEL
• UniProt AC: Q27389
• Protein Name: 60S ribosomal protein L13a
• Gene Name: rpl-16
• Organism: Caenorhabditis elegans.
• Sequence Length: 202
• Protein Sequence: MGLSNRAIIIDGKNHLLGRLASIVAKKLLQGDKVVVLRAEEIVISGNFHRSKLKYMSFLRKRCNINPARGAFHYRAPGKIFWRTVRGMLPHKTNRGNEALKNLRAYEGVPAKYQKTKSLHAPSASRFRLQPRRKFCVVGRLSHEVGWQFQDVVAKLEAKRKVKGAAYFEQKKKMDKLAVQAKKNAAPKIAQYQKIIEALGYN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MGLSNRAIIID ----CCCCCCEEEEC	20.67	26392051
106	Phosphorylation	ALKNLRAYEGVPAKY HHHHHHHHCCCCCCH	13.54	27067626
118	Phosphorylation	AKYQKTKSLHAPSAS CCHHCCCCCCCCCCH	30.53	28854356
167	Phosphorylation	RKVKGAAYFEQKKKM HHHCCHHHHHHHHHH	13.71	27067626

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL13A_CAEEL !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL13A_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL13A_CAEEL !!

Protein-Protein Interaction

Oops, there are no PPI records of RL13A_CAEEL !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.