MLRH_CAEEL - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MLRH_CAEEL
• UniProt AC: Q09510
• Protein Name: Myosin regulatory light chain {ECO:0000303|PubMed:10427096}
• Gene Name: mlc-4 {ECO:0000312|WormBase:C56G7.1}
• Organism: Caenorhabditis elegans.
• Sequence Length: 172
• Subcellular Localization: Cytoplasm . Cytoplasm, cytoskeleton . Forms a filamentous structure which may co-localize with actin.
• Protein Description: Regulates myosin II activity and organization during embryo elongation. May be involved in the organization of mlc-5 into bundles. [PubMed: 19675126 Required maternally for cytokinesis during meiosis and mitosis in the early embryo and for the establishment of embryonic anterior-posterior polarity]
• Protein Sequence: MASRKTVNRRQRPQRATSNVFAMFDQAQIQEFKEAFNMIDQNRDGFIDQEDLKDMFASLGKEVTEQFIDSMINEAPGAQPINFTMFLTLFGEKLTGTDPEEVIRNAFQCFDEDNSGKLNEEHLRELLTTMGERYSEEQVDELFRDAPIKGGQFDYVEFTRMLKHGTKDKDEA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
17	Phosphorylation	RQRPQRATSNVFAMF HHCCHHHHHHHHHHC	24.03	28854356
18	Phosphorylation	QRPQRATSNVFAMFD HCCHHHHHHHHHHCC	29.97	22923814

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MLRH_CAEEL !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MLRH_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MLRH_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.