dbPTM

DPY10_CAEEL - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DPY10_CAEEL
UniProt AC	P35800
Protein Name	Cuticle collagen dpy-10
Gene Name	dpy-10
Organism	Caenorhabditis elegans.
Sequence Length	372
Subcellular Localization
Protein Description	Nematode cuticles are composed largely of collagen-like proteins. The cuticle functions both as an exoskeleton and as a barrier to protect the worm from its environment..
Protein Sequence	MKNNAKEDYRTFSLTTNYSRQMIYRCVTGLQIGFSLFSFIIVCVALPIMYNHVQNTITYVDREMAYCEVRFLYFYCIKFFSTLQRSNDEAALELQYGKMRMTGNRTARGAYGSGASHGFRPTAYGDEITGAPLETECPGCCIPGPPGPRGSSGTPGKPGLPGNAGKPGMPGTTPNQTCPLNQVREPPPCRPCPKGPPGIKGWPGFPGDVGPPGPPGLKGIDGEDGAPGETGPTGPPGYRGGPGAPGDKGPTPEGDLKEGPPGDEGPPGPIGAPGMPGLPGRNGLTGGQGERGWPGVSGESGEPGYPGPEGPMGGQGPPGEPGVCVCQNVDSILLINPGPQPRIRADDYNSDDGYGGSRGGGDRAGYQGYGRK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of DPY10_CAEEL !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DPY10_CAEEL !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DPY10_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DPY10_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of DPY10_CAEEL !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DPY10_CAEEL

Related Literatures of Post-Translational Modification