| UniProt ID | SEM5_CAEEL | |
|---|---|---|
| UniProt AC | P29355 | |
| Protein Name | Sex muscle abnormal protein 5 | |
| Gene Name | sem-5 | |
| Organism | Caenorhabditis elegans. | |
| Sequence Length | 228 | |
| Subcellular Localization | Cell membrane . Targeted to the leading edge of Q neuroblasts by mig-13. | |
| Protein Description | Adapter protein which modulates signaling mediated by several receptor tyrosine kinases such as egl-15 and let-23 probably acting upstream of let-60/ras. Negatively regulates vulva induction probably downstream of let-23. [PubMed: 1372395] | |
| Protein Sequence | MEAVAEHDFQAGSPDELSFKRGNTLKVLNKDEDPHWYKAELDGNEGFIPSNYIRMTECNWYLGKITRNDAEVLLKKPTVRDGHFLVRQCESSPGEFSISVRFQDSVQHFKVLRDQNGKYYLWAVKFNSLNELVAYHRTASVSRTHTILLSDMNVETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVCPYNSNKSNSNVAPGFNFGN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 13 | Phosphorylation | EHDFQAGSPDELSFK CCCCCCCCCCCCEEE | 31.99 | 28854356 | |
| 170 | Phosphorylation | FDFNPQESGELAFKR HCCCHHHCCCEEEEC | 32.11 | 28854356 | |
| 207 | Phosphorylation | RGIFPSNYVCPYNSN CCCCCCCCCCCCCCC | 14.04 | 27067626 | |
| 216 | Phosphorylation | CPYNSNKSNSNVAPG CCCCCCCCCCCCCCC | 50.14 | 30078680 | |
| 218 | Phosphorylation | YNSNKSNSNVAPGFN CCCCCCCCCCCCCCC | 39.51 | 30078680 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SEM5_CAEEL !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SEM5_CAEEL !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SEM5_CAEEL !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
