dbPTM

SIP1_CAEEL - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SIP1_CAEEL
UniProt AC	Q20363
Protein Name	Stress-induced protein 1
Gene Name	sip-1 {ECO:0000312\|EMBL:CAA84703.1}
Organism	Caenorhabditis elegans.
Sequence Length	159
Subcellular Localization
Protein Description
Protein Sequence	MSSLCPYTGRPTGLFRDFEDMMPYWAQRHSMLNNFNNIVPQQLNEVENTAQKFCVKLDVAAFKPEELKVNLEGHVLTIEGHHEVKTEHGFSKRSFTRQFTLPKDVDLAHIHTVINKEGQMTIDAPKTGSNTTVRALPIHTSAGHAVTQKPSSTTTTGKH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MSSLCPYTGRPTGL -CCCCCCCCCCCCCC	22.34	27067626
24	Phosphorylation	DFEDMMPYWAQRHSM CHHHHHHHHHHHHHH	8.76	27067626
30	Phosphorylation	PYWAQRHSMLNNFNN HHHHHHHHHHHCCCC	27.44	30078680
127	Phosphorylation	MTIDAPKTGSNTTVR EEEECCCCCCCCEEE	44.79	30078680
129	Phosphorylation	IDAPKTGSNTTVRAL EECCCCCCCCEEEEE	35.91	30078680
140	Phosphorylation	VRALPIHTSAGHAVT EEEEEEECCCCCEEC	22.46	30078680
141	Phosphorylation	RALPIHTSAGHAVTQ EEEEEECCCCCEECC	20.35	30078680
147	Phosphorylation	TSAGHAVTQKPSSTT CCCCCEECCCCCCCC	31.49	21082442
151	Phosphorylation	HAVTQKPSSTTTTGK CEECCCCCCCCCCCC	47.56	21082442
152	Phosphorylation	AVTQKPSSTTTTGKH EECCCCCCCCCCCCC	38.00	21082442
153	Phosphorylation	VTQKPSSTTTTGKH- ECCCCCCCCCCCCC-	32.28	21082442
155	Phosphorylation	QKPSSTTTTGKH--- CCCCCCCCCCCC---	33.37	21082442
156	Phosphorylation	KPSSTTTTGKH---- CCCCCCCCCCC----	41.98	21082442

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SIP1_CAEEL !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SIP1_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SIP1_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of SIP1_CAEEL !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SIP1_CAEEL

Related Literatures of Post-Translational Modification