LAG2_CAEEL - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LAG2_CAEEL
• UniProt AC: P45442
• Protein Name: Protein lag-2
• Gene Name: lag-2
• Organism: Caenorhabditis elegans.
• Sequence Length: 402
• Subcellular Localization: Membrane; Single-pass type I membrane protein.
• Protein Description: Putative intercellular signal for lin-12 and GLP-1 receptors..
• Protein Sequence: MIAYFLLLLTCLPVLQARVEVHQEFISSKRVSVRFEIVTESHSPNRPVTFDLFPRGPKTNIILLDTFNPVFNFSIQLVQPFTGQPLGDRIYRKVQFSGTNQPWINDTFTTTSGISLSVATEVTCARNYFGNRCENFCDAHLAKAARKRCDAMGRLRCDIGWMGPHCGQAVDPRKCSCENDGICVSSMIHPSQPNQTSSNEQLICECTNGFTGTRCEIFGFNQFQLTAPRPDACSVKDACLNGAKCFPNGPKVFCSCAVGFIGEFCEISLTTTTPTTVEITVSTSGYSSAVYITVALFVIFSIIIGCFKYKFKPMRQQALARGQVPEPYKMPETKSMLIDPEASEAQKKVFTIEGSVQKIDEEVRYTSAPRKYESNNEYAVIQKSTPPPPSLSPPSIPACHYV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
72	N-linked_Glycosylation	DTFNPVFNFSIQLVQ ECCCCEEEEEEEEEC	29.95	-
105	N-linked_Glycosylation	GTNQPWINDTFTTTS CCCCCCCCCCEEECC	38.10	-
194	N-linked_Glycosylation	MIHPSQPNQTSSNEQ CCCCCCCCCCCCCCE	50.56	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LAG2_CAEEL !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LAG2_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LAG2_CAEEL !!

Protein-Protein Interaction

Oops, there are no PPI records of LAG2_CAEEL !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.