UniProt ID | LAG2_CAEEL | |
---|---|---|
UniProt AC | P45442 | |
Protein Name | Protein lag-2 | |
Gene Name | lag-2 | |
Organism | Caenorhabditis elegans. | |
Sequence Length | 402 | |
Subcellular Localization |
Membrane Single-pass type I membrane protein. |
|
Protein Description | Putative intercellular signal for lin-12 and GLP-1 receptors.. | |
Protein Sequence | MIAYFLLLLTCLPVLQARVEVHQEFISSKRVSVRFEIVTESHSPNRPVTFDLFPRGPKTNIILLDTFNPVFNFSIQLVQPFTGQPLGDRIYRKVQFSGTNQPWINDTFTTTSGISLSVATEVTCARNYFGNRCENFCDAHLAKAARKRCDAMGRLRCDIGWMGPHCGQAVDPRKCSCENDGICVSSMIHPSQPNQTSSNEQLICECTNGFTGTRCEIFGFNQFQLTAPRPDACSVKDACLNGAKCFPNGPKVFCSCAVGFIGEFCEISLTTTTPTTVEITVSTSGYSSAVYITVALFVIFSIIIGCFKYKFKPMRQQALARGQVPEPYKMPETKSMLIDPEASEAQKKVFTIEGSVQKIDEEVRYTSAPRKYESNNEYAVIQKSTPPPPSLSPPSIPACHYV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
72 | N-linked_Glycosylation | DTFNPVFNFSIQLVQ ECCCCEEEEEEEEEC | 29.95 | - | |
105 | N-linked_Glycosylation | GTNQPWINDTFTTTS CCCCCCCCCCEEECC | 38.10 | - | |
194 | N-linked_Glycosylation | MIHPSQPNQTSSNEQ CCCCCCCCCCCCCCE | 50.56 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LAG2_CAEEL !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LAG2_CAEEL !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LAG2_CAEEL !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of LAG2_CAEEL !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...