| UniProt ID | BTF3_CAEEL | |
|---|---|---|
| UniProt AC | Q18885 | |
| Protein Name | Transcription factor BTF3 homolog | |
| Gene Name | icd-1 | |
| Organism | Caenorhabditis elegans. | |
| Sequence Length | 161 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | May act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.. | |
| Protein Sequence | MDSKAIAERIKKLQAQQEHVRIGGKGTPRRKKKVIHKTAAADDKKLQSNLKKLSVTNIPGIEEVNMIKDDGTVIHFNNPKVQTSVPANTFSVTGSADNKQITEMLPGILNQLGPESLTHLKKLANNVTKLGPDGKGEDEDVPELVGDFDAASKNETKADEQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 54 | Phosphorylation | QSNLKKLSVTNIPGI HHHHHHCCCCCCCCC | 35.46 | 22923814 | |
| 56 | Phosphorylation | NLKKLSVTNIPGIEE HHHHCCCCCCCCCEE | 24.85 | 22923814 | |
| 84 | Phosphorylation | NNPKVQTSVPANTFS CCCCEECCCCCCEEE | 14.71 | 28854356 | |
| 89 | Phosphorylation | QTSVPANTFSVTGSA ECCCCCCEEEEECCC | 21.28 | 28854356 | |
| 93 | Phosphorylation | PANTFSVTGSADNKQ CCCEEEEECCCCCHH | 24.99 | 28854356 | |
| 95 | Phosphorylation | NTFSVTGSADNKQIT CEEEEECCCCCHHHH | 24.08 | 30078680 | |
| 152 | Phosphorylation | VGDFDAASKNETKAD HCCCCHHHCCCCCCC | 37.42 | 30078680 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BTF3_CAEEL !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BTF3_CAEEL !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BTF3_CAEEL !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PEX19_CAEEL | prx-19 | physical | 14704431 | |
| NACA_CAEEL | Y65B4BR.5 | physical | 18692475 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
